(data stored in SCRATCH zone)

EMBL: CP001163.PE50

CP001163.PE50        Location/Qualifiers
FT   CDS_pept        35267..37240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0072"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34437"
FT                   /protein_id="ACI34437.1"
FT                   /translation="MSIAGLREEPAQDWLSLHKRLASDGLYITMQEGELVVKDGWDRAR
FT                   EGVALSSFGPLWTAEKLGRKLGEYQPVPTDIFSQVGTPGRYDPEAINVDIRPEKVAETE
FT                   SLKQYACRHFAERLPEMARNGELESCLDVHRTLATAGLWMGIQHGHLVLHDGFDKQQTP
FT                   VRADSVWPLMTLDYMQDLDGGWQPVPKDIFTQVIPGERFRGRNLGTQAVSDYEWYRMRM
FT                   GTGPQGAIKRELFSDKESLWGYTTVQCESLIEDMIAGGNFSWQACHEMFARKGLMLQKQ
FT                   HHGLVIVDAFNHELTPVKASSIHPDLTLSRAEPQAGPFEIAGADIFERVKPECRYNPEL
FT                   AASDEVEPGFRRDPVLRRERREARAAAREDLRARYLAWKEHWRKPDLRYGERLREIHAA
FT                   CRRRKAYIRVQFRDPQLRKLHYHIAEVQRMQALIRLKESVKEERLSLIEEGKWYPLSYR
FT                   QWVEQQAVQGDRAALSQLRGWDYRDRRKDKRRTTNADRCVILCEPGGTPLYEDTGVLEA
FT                   RLQKDGSVRFRDRRNGELVCVDYGDRVVFYHHQDRNELVDKLNLIAPVLFDREPGMGFE
FT                   PEGSYQQFNDVFAEMVAWHNAAGITGNGHFVISRPDVDLHRQRSEQYYHEYIRQQKSIS
FT                   GGHGASYAPVQDNEWTPPSPGM"
     atgtcgattg ccgggctgcg tgaagagccc gcacaggact ggttatcttt gcataaacgg        60
     ctggccagtg atggtctgta tatcacgatg caggaagggg aactggtggt gaaggatggc       120
     tgggacagag cgcgggaagg tgttgcactc agttcgttcg gaccgttatg gacagctgaa       180
     aaactggggc ggaaactggg ggaatatcag cctgtaccga cagatatttt cagtcaggtg       240
     gggacacccg gtcgttatga tccggaagcc ataaacgttg atatccggcc ggaaaaagtg       300
     gcagaaacgg agagtctgaa acagtacgcc tgccgtcatt ttgccgaacg cttaccggaa       360
     atggcgagaa atggtgagct ggaaagttgc ctggatgtgc acagaactct ggcaacggct       420
     ggattatgga tggggatcca gcacgggcat ctggtactgc atgatggatt tgataaacaa       480
     cagacaccag tacgtgcaga cagtgtgtgg ccgttaatga cgctggatta tatgcaggat       540
     ctggatggtg gatggcagcc tgtaccgaag gatattttta ctcaggttat acccggagaa       600
     cggttccggg gacgtaatct tggtactcag gctgtcagtg attacgaatg gtatcgtatg       660
     cggatgggga caggtccaca gggagcaata aagcgcgaac tgttttctga taaggaaagt       720
     ctgtgggggt acacaactgt tcagtgtgag tcgttgattg aagatatgat cgcgggcggg       780
     aatttcagct ggcaggcgtg ccatgagatg tttgcgcgta aagggcttat gttgcagaaa       840
     cagcatcatg gtcttgtgat tgtggatgcg tttaatcatg agctcacacc agtgaaggcc       900
     agcagtatcc acccggattt gacgttatcc agggctgagc cgcaggcagg gccatttgag       960
     attgcaggtg cagatatatt tgaacgggtg aagcctgaat gtcgctacaa tccggaactt      1020
     gctgccagcg atgaagtgga gcccggcttc cggcgcgatc ctgtactgcg tcgtgaacgc      1080
     cgtgaagccc gtgcagctgc gcgggaagat ttgcgcgcgc gttatcttgc atggaaggag      1140
     cactggcgta aacccgactt acgttacgga gaacggttac gggaaattca tgctgcctgc      1200
     cgtcggcgca aggcgtatat ccgtgtgcag ttccgggatc cacaattgcg taagctgcat      1260
     taccatattg cggaagtgca gcgtatgcag gcgctgatca ggctgaagga gagtgtgaag      1320
     gaagagcggt tgtcactgat tgaggagggt aagtggtatc ctttgtccta ccggcagtgg      1380
     gtggagcaac aggcggtaca gggagacaga gctgcattat cacagttacg tggctgggat      1440
     tatcgtgatc gtcgcaaaga caagcgacga acaacgaatg ccgaccgctg cgtgattctc      1500
     tgtgaaccgg gaggaactcc actttatgaa gacactggcg ttctcgaagc ccgtctgcag      1560
     aaagatggca gtgtgcgttt tcgtgatcgg aggaatggcg agttagtctg tgtggattat      1620
     ggggaccgtg tggtgttcta ccatcatcag gacagaaatg aactggtgga taagctgaat      1680
     ctgattgctc ctgtattgtt tgatcgtgag ccaggaatgg gttttgaacc ggaaggctca      1740
     tatcaacagt ttaatgatgt atttgcggaa atggtggcct ggcataatgc agctggaata      1800
     accggaaatg gacactttgt aatcagccgc ccggatgtgg atttacatcg tcagcgtagt      1860
     gaacagtact accacgaata tatcaggcaa cagaaaagca tatccggggg gcatggcgca      1920
     tcttatgctc cagttcagga taatgagtgg acgccaccat cacctggaat gtag            1974
//

If you have problems or comments...

PBIL Back to PBIL home page