(data stored in SCRATCH zone)

EMBL: CP001163.PE52

CP001163.PE52        Location/Qualifiers
FT   CDS_pept        39533..49042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0076"
FT                   /product="glycosyltransferase sugar-binding region
FT                   containing DXD motif family protein"
FT                   /note="identified by match to protein family HMM PF04488;
FT                   match to protein family HMM TIGR01586"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34469"
FT                   /protein_id="ACI34469.1"
FT                   /translation="MIHPGSSLDKAINNTRVKNVSTDVKHGQIQERKRNFIYKKNDDIS
FT                   SRFKLYSSLVKQKNATEDVVLIGKMILDEVRSYRTIHNDRNIVSNSGNWKTSFLCNLAR
FT                   LLYSIFNGSNYFCSREGENNSSPSSTLLTIHQPEKQELLQQKSIKHLPTSNNIDGYIKI
FT                   RKTRGAEDQTTTITQSLIINELLNGVDRNTIPFQKISELNDIIHSYENMQIKNSRKGIE
FT                   ILVKQGELLSSLINDNKGNKQLSDNASKIINLLGIEYQSHKVDIEPFIHAVWVAGAPPD
FT                   NTFSYITAFLNTYKDYTYLLWIDPNAFGAAKFSGILKNIAMNYAIMRLRRTNPHLAEEM
FT                   NEVILKIQNIQNETIEFKETRERLKELENRYKSLTSETKEKFNVFFLESMIGMQDNYFT
FT                   YCISNGISNTDDISRLDFLTNVLKLSPEVQNDFKSTVEKNKRDIDLLKNTISQKFGDRF
FT                   QLRDINTLESFKKPQDYFFYQQEMLLRWNYAAASDQVRINILKEYGGIYTDTDILPAYS
FT                   DKVSQIINEKSDDKRFFEDLKLRRIISESILSLIKGEKYSIKHDGLDETTLNQLNNILS
FT                   EIEKLTIDDYFKPVETKVVRDTFKIFKRYQKWTENTWNIRGNNNFMLTHKGSKCIDFIL
FT                   SGQKKQYLELQRIRDNISYNNLFYTTEDLKSLNNVAIGGIPAKKYLEHGLFSEYRQDGT
FT                   IPYVVSTLNISGPDMIMRQMKKYYKSLGRIGEVHIKDNKLSDVNFLGVYASSNKDNKSF
FT                   NWLNPVSVGINDITPDDESSWAVRNNDINKILFEKINCHVPEKLPTSLYYEIDSRSFFQ
FT                   GWDNKSIKHVTEINKDLIKDINLLLTSSNIDVKLLIKLDRELYAISSKIDNPLALRSIR
FT                   TLQLQLANYVTSNTFEPENTINFIYDFYRKKQDDLLSAIKLFSRNDADTKIIVWYNSVM
FT                   EKNVFLREVISCVLRSKKVDSYINENKKNLSKEDAGALRDYAKLKMKELFSMLDDDGYK
FT                   KIITTNAYIKERDKLSGIIYNIENSIISGHESFDIIRSNQHEWGDLSTVEQFKKFEFYV
FT                   KSELSSAKSIFDDIKNKYITDPETKRNVLYHQLDSDIKERIAFLDISHYAYPGSLLEKL
FT                   QLSGYVFSDINIIAEYLLASYGVSGHYSHGVVYPAPSDKLLELLRRHTKSNSEWIEKIT
FT                   PYVYDILSDNVSNVLRPPLSEEQKKILNDIKLEISKSVSEQYFMKLTEQKSSVIGIKYS
FT                   VDFDRYNENLFLSLPINQNLTLPFMYRYFEMLYDIHIGIIENKANREFIYSKFSSLNLD
FT                   FLINDERVLNLEGLIKKYKYLSLSEIHRTLTNSTSFADISIPLLQTICPSITTIIKKTE
FT                   YYGHQLTNAMTVASVVKPYDFSNLGAINSIDKSVSDVPALHTIVEQAKYNLLSWNDFYN
FT                   THASIWDTIARQHKSTNIEFHPQSLLFDRDSKGKCLGLSLLYLDTGGYGGGYQKLRHNI
FT                   DTASTLYQTKYNDNLKLSNRDDFFLRKTQRIITMSNELGNNRLKNAQLEVLELKDPILT
FT                   EGILYQRRISSLLITTEYHSLALQQISSFWRVTDPNFGHCDFHSLAQALTFIKNITSNR
FT                   NFSSLYGSGIVKIYFSESLNNWKYIKLPLVQTGSLLRDIYLTTPEKLSTSGGSLNIMGH
FT                   LVPVSFIYDIGGVINGNRISESTDVKNKIRSLKINGDILQHYINTHYLSEEQTQKIKDI
FT                   VDFLGIQDNTIKVKLESDIKPISEIQQPLHSILSRQKEHVKNLLSGLLDEFSNKLRKQG
FT                   LSLKTNVLSVNNFKESKINSDTVEVTVTDLQGRLYRVDIDTRVIGLTFKEGINSLSEAL
FT                   EHMNIDAIMSVIGLVQYARMIKMNDNISAIDHAGAVSDIKNIVDKFLGGILTLTNNRVY
FT                   NPGGVSGASLEGFISSGLEVCASRMGGTAGRYLSNVAKVIKLPLLDIGINIWSLYDSSL
FT                   NHAKATTQIEYISTAIDVSFSSINTALSIGAIAYPPLAIAIVPITIFSHEVKNYAVYVN
FT                   QINERHKLWLEAEKYLDNGSAKVLSINKATGIIDLSNNQVLGNIYLDMRENPPILHGEK
FT                   SYNSGKNIGSHPDMTDREIMESRAYNFACTKLSDAGEPDIFGWGDKEICNSMELSESQL
FT                   ANGYSNRQWPSQIPVIPEGIYNTVYLGYGETLRANTEVTLSSTGYFYEIARAYTDDELS
FT                   EPLLTVCNQHSHVIGGKEPLTIIIPAIEHGMLGSNLHMIERFKNYNFSISGGKGGIKLM
FT                   VGGIGDYNIECTPGVRNIISFEQLSRDFNLDLDLSDGRKQNFNFHHPSGFYSGKVMSIT
FT                   QKGINAVVGTKLGYDKIRGNNLDNTFSLGSGGGVIYSGGGSNTYFVPATLQDNLHIYIS
FT                   EKSNGNHIILGDMHSRLSIECHFSNNEREFIKMGYYNGCDVILESDTIQKIKSFAKNIT
FT                   IQTADGVMANWDDKLNTLSVYSIDMIAWRDKNKTAKEPLPVDVIQLTNWRMHNTCSLFY
FT                   DKYQVDIEANKLTYTVLFPDTELPVQLNYTSIIYGNHGAKYTFLNSGSKTIDIHILDKN
FT                   SDYDTFDFRNIIFEHYTNEIFISFDNQGGFVISILNNATSEAANINVFRKNMTSLDSSG
FT                   SLIYLPSGDIYHISDIYKMSRGRKSFKLNVEKKPDIDDIINVAILETSYLQIKKIPNND
FT                   DSDYILCLDNPNLSSYTLNFNDLSGYISSLWDNIRGSFTPFHKNTVNIAPNEKKYISLI
FT                   GLDKLSFNIDVFRQALEVKNKNSYKISKFTWETYGDIVVSPEDRISHLELDGFNYFSQP
FT                   ELDTPISDSFSYLYDNFQIVDSDVHIKLLHLNRETKQITPHRIILKRYFIDSFAKTSIT
FT                   DREKNIYPVICDSPDHFTSDIYRHPFRIVLGNKTLYPSEELVKFISTSKEYLSNMDVIN
FT                   NVIVPQKTTKKNKLSIVSLNSNIKNDIVLSGVMTGTSKIFHLNNSGDLLLTTSKTHGGG
FT                   VVVIFKDFINNWWKYNLTLITVPIDNKLSDNRINITPMGIKIQETVSGNDRLFFYPTPL
FT                   KNGCFILHNPLYSNSFPSLYSHELFDLIEAYRNPTYSYLQNNIINRYIHTVSEYAGKDG
FT                   IANMSLSIYAYSTCRFWSKESVAVGDTIKLSNYEHIEFSFNSFSKDYFREQNSDIYKIF
FT                   FKIASSSNSVVVDKNTLTQKNFLENNTFFSITGIDESLYEKHIIFITLKVIVPSKK"
     atgattcatc ctggctcttc tttagataaa gcaattaaca atacaagagt taaaaatgtt        60
     agtactgatg ttaaacatgg ccaaattcaa gagagaaaaa ggaactttat ctataaaaaa       120
     aatgatgata tctcatccag atttaaactt tacagttcgc tcgtaaagca gaaaaatgcg       180
     acagaagatg ttgttttaat aggcaaaatg attttagatg aagttagaag ttacagaact       240
     atacataatg atcgaaatat cgtaagtaac tcaggaaact ggaaaacatc ttttttatgt       300
     aatcttgcta gactactata tagcatattt aatggtagta actatttttg ttcccgagag       360
     ggtgaaaata attcatcccc cagttctact ctacttacta tacatcagcc tgaaaagcag       420
     gaactattac aacaaaagag tatcaaacat ttaccaacaa gtaataacat cgacggatac       480
     attaaaataa gaaaaacaag aggcgctgaa gatcaaacaa caactatcac tcaaagtttg       540
     ataattaatg agttgttaaa tggagttgat agaaatacca tcccttttca gaaaataagt       600
     gagctcaatg atatcataca ttcatatgaa aatatgcaaa ttaaaaatag tcgaaaaggt       660
     atagaaatac ttgttaagca gggagagctg ttatcatcat taataaatga taataaagga       720
     aataaacaat tatcagacaa tgcatctaaa ataataaact tattgggtat agagtatcag       780
     tcacataaag tagacataga gccatttata catgcagtat gggttgctgg cgcacctcct       840
     gataatacat tttcatatat aacggcattt ttaaatacat ataaagatta tacctacctg       900
     ctctggattg atcctaatgc ctttggtgcg gccaagttta gtgggatttt aaaaaatata       960
     gcgatgaatt atgcaattat gcgtttgaga agaacgaatc cacatttagc ggaagaaatg      1020
     aatgaagtga tattaaaaat acaaaacata caaaatgaaa ctatagaatt taaggaaaca      1080
     agagaaagat tgaaggaact tgaaaataga tataaatcat taacgagtga aactaaagaa      1140
     aaattcaatg ttttttttct tgagtcaatg ataggtatgc aagacaacta ttttacatat      1200
     tgtatatcaa acggaatatc aaatactgat gatatatcca gacttgactt tttaactaac      1260
     gttttaaaac tttcaccaga agttcaaaat gactttaaat ctacagtaga gaaaaacaaa      1320
     agagatatag acttattaaa aaatacaata tctcaaaaat ttggggatag atttcaactg      1380
     agagatatta acacattgga gtcatttaaa aaaccacaag attatttttt ttatcaacaa      1440
     gagatgctat taagatggaa ctacgccgct gcatcagatc aggtaagaat taatatattg      1500
     aaagagtatg gagggattta taccgataca gatattcttc ctgcatattc agataaagta      1560
     tcacagataa taaatgaaaa aagtgatgat aagaggtttt ttgaagattt aaaactaaga      1620
     aggattatat cagaatctat tctgtctctg ataaaagggg aaaagtactc aattaaacat      1680
     gatggattag atgaaacaac actaaatcag ttaaataaca tattgagtga aatagaaaaa      1740
     ctgacgatag atgattattt taaacccgtt gagacaaaag ttgtcagaga tacatttaaa      1800
     atttttaaaa gatatcaaaa atggacagaa aacacctgga atattagagg gaataataat      1860
     ttcatgttaa ctcacaaggg aagtaaatgt attgatttta ttctatcagg acagaaaaaa      1920
     cagtatttag aactccaacg catcagagat aatataagtt ataataatct attttatact      1980
     acagaggatc taaagtcttt aaataatgtg gcaataggag gaatacctgc aaagaaatat      2040
     ttagaacacg gtttgttttc tgaatataga caggacggta caattcctta tgtggttagc      2100
     actttaaata tatctggccc agacatgatt atgcgacaaa tgaaaaaata ctataaatct      2160
     cttgggcgca taggtgaagt gcatattaaa gataataaat tgagtgatgt taattttttg      2220
     ggtgtatatg caagttcaaa taaagacaat aaaagtttta actggctaaa tccagtgagt      2280
     gttggtatta atgatattac accagatgat gaaagctcat gggctgtcag aaataatgat      2340
     ataaataaaa ttctattcga aaaaataaac tgccatgtac ccgaaaaact acctacctcc      2400
     ctatactatg aaatcgattc gcggtctttt tttcaggggt gggataataa aagcataaag      2460
     catgttacag agattaataa agacctcatc aaagatatta atttattatt aacatcgtct      2520
     aatattgatg ttaaactttt aataaaactg gatcgtgaat tatatgcgat tagcagtaaa      2580
     atagataatc cgttggcctt gcgctctata agaaccttac agctacaatt agctaattac      2640
     gtaacttcga atacatttga acctgaaaac acaattaatt ttatttatga tttttataga      2700
     aaaaaacaag atgacttact cagcgcaata aaattatttt cgcgtaatga tgccgataca      2760
     aaaattattg tctggtacaa ttccgtaatg gaaaaaaatg tgtttctccg agaggttata      2820
     tcatgtgttc tacgaagtaa aaaagtagat agttatataa atgaaaacaa aaaaaactta      2880
     tctaaggagg atgccggagc tttaagagat tatgcaaaat taaaaatgaa agaactattt      2940
     tcgatgttag atgatgatgg ttataaaaaa atcataacta caaatgcata tattaaagag      3000
     agggataaac tatcaggcat tatatacaac atcgaaaatt cgattatatc gggtcatgaa      3060
     tcatttgata taatacgaag caatcaacat gagtgggggg atttatcaac ggtagagcaa      3120
     tttaaaaaat ttgagttcta tgtgaaaagt gaattatctt cggctaagtc aattttcgat      3180
     gatataaaaa acaaatatat aacagatcct gaaacaaaac gaaacgtact ctaccatcag      3240
     ttagatagtg atattaaaga gcgaatagca tttctcgata tatcccacta tgcatatccg      3300
     ggtagtttat tagaaaaatt acaattaagt ggctacgttt tttctgatat caacataatt      3360
     gcagaatact tattggctag ttacggagtt tctggacatt attctcacgg cgtggtatat      3420
     ccagctccat ctgataaatt acttgagcta ttaagaagac atacaaagag caattctgag      3480
     tggatagaaa aaataacccc atatgtttat gatatattat ccgataatgt atccaacgtc      3540
     ttgcgccccc ctttatcaga agaacagaaa aaaatattga atgatataaa attagaaatt      3600
     agtaaatctg tatcagaaca gtatttcatg aagttgacag agcaaaaatc atcagttatt      3660
     ggtattaaat attctgttga ttttgacaga tacaatgaga atttgttttt gtctttacct      3720
     ataaatcaaa atttaacgct gccttttatg tatcgctact tcgagatgct atatgacatt      3780
     cacattggaa taatagaaaa caaggcaaac agggagttta tatatagtaa gttttcatct      3840
     ttaaacctgg attttttgat taatgacgag agagttttga atcttgaagg tttaataaaa      3900
     aaatataaat atttatcgct gagtgaaata catagaactt taacaaatag tacttcattt      3960
     gcagatattt ctataccatt attgcagacc atatgtccca gcataacaac aataataaaa      4020
     aaaacagaat attatgggca tcagttaaca aatgctatga ctgttgcttc agtggttaaa      4080
     ccatatgact ttagcaatct tggtgccata aatagtatag ataaatccgt ttctgatgtg      4140
     cctgcattgc atacaattgt tgaacaagca aaatataatt tactttcatg gaatgatttt      4200
     tataacactc atgcgtcaat atgggataca atagcaagac agcataaaag tacaaatatc      4260
     gaatttcacc cacaaagtct tctttttgat agagattcga aaggaaagtg ccttggttta      4320
     tctcttctgt atcttgatac aggggggtac ggaggcggat atcaaaaact gaggcacaat      4380
     attgacactg ccagcacatt atatcaaaca aaatacaatg acaatctaaa attatctaac      4440
     cgtgatgatt tctttttaag aaaaacacag cgtatcatta caatgtccaa tgagttaggt      4500
     aataacaggt taaaaaatgc acagttagag gttctggaat tgaaagaccc tatactaact      4560
     gaaggcatat tataccagcg tcgtatatca tctcttttaa taacaacaga atatcattca      4620
     cttgcattac aacaaatatc ttctttttgg agagtaactg atcctaattt tggtcattgt      4680
     gactttcatt ccttagcaca ggctttaacg tttataaaaa atataacgag caatcgtaac      4740
     ttttcatctt tatatggaag tggcattgtt aaaatttact tcagtgaatc tcttaataat      4800
     tggaagtata ttaagctccc ccttgttcag actggttctt tgttaagaga catatattta      4860
     acaaccccag aaaaattatc cacaagcggg ggttcattaa atattatggg gcatctcgtg      4920
     cctgtcagtt ttatttatga tatcggaggg gttattaatg gtaacagaat aagtgaaagt      4980
     acagatgtga aaaataaaat taggagctta aaaataaatg gggatatttt acaacattat      5040
     ataaatacgc attatttgtc agaggagcaa actcagaaga taaaagatat tgtggatttt      5100
     ttaggtattc aggataacac aataaaagtt aagcttgaaa gtgatattaa acctataagt      5160
     gaaatccaac agccccttca ttccattctt tcacggcaga aagaacacgt aaagaattta      5220
     ctatctggat tgcttgatga gttttcaaat aagttaagaa agcaaggtct ttcacttaaa      5280
     acaaatgttc tttcagttaa taacttcaaa gaatcaaaga taaatagtga tacagtggag      5340
     gttacagtaa cagatctgca aggaagactt tatcgtgttg atatagatac aagagttatt      5400
     ggcttaactt ttaaagaggg gataaatagt ttatccgaag cactcgaaca catgaatatc      5460
     gatgcgatta tgtctgttat tggcttggtt caatatgcac gaatgataaa aatgaatgac      5520
     aatattagtg caatagatca tgcaggagca gtatcagata taaaaaatat tgtagacaaa      5580
     tttttaggcg gaattttgac tcttactaat aatcgcgtat ataatcctgg cggtgtatct      5640
     ggtgcctcgc ttgaaggatt tatatcttct gggttggagg tgtgtgcttc aagaatgggt      5700
     ggcaccgcag ggcgttatct tagcaatgtg gcaaaagtaa ttaaattacc tttgctagat      5760
     ataggcataa atatttggtc attatatgat tcttcattaa atcatgctaa agccaccaca      5820
     caaattgaat atatatcaac agcaatagat gtatcttttt catctataaa tacagctttg      5880
     tcaataggcg caatcgcata tcctcctttg gcaatagcta tagttccgat aactattttt      5940
     tctcatgaag taaaaaacta tgctgtttat gtgaatcaaa ttaatgagcg ccataagtta      6000
     tggctcgaag ctgaaaagta tctggacaat ggaagtgcaa aggttctaag cattaacaaa      6060
     gccacaggca taatcgattt atcaaataat caggtgttag gtaatattta tttagatatg      6120
     agagaaaatc ctccaatatt acacggtgag aaatcatata atagcggaaa gaatattggt      6180
     agtcatcctg atatgactga cagagagatt atggagtcta gagcatacaa ttttgcatgc      6240
     acaaaactct cagatgcagg tgaacccgat attttcggtt ggggagataa ggaaatatgt      6300
     aattcaatgg aattatcaga atcacaatta gctaatgggt attctaaccg ccaatggcct      6360
     tctcagattc cagttattcc agaaggaatt tataatacag tatatcttgg atatggagaa      6420
     acattgcgag ctaatactga agttacattg agtagcactg gttactttta cgagattgca      6480
     agggcatata ctgatgatga actatctgag ccattattaa cagtatgtaa ccaacatagt      6540
     catgttattg gtggaaaaga accattaaca attattattc ccgctattga acatggtatg      6600
     cttggctcta atctacatat gattgaacgt tttaaaaact ataatttctc gatatcagga      6660
     gggaagggag ggataaaatt aatggttggt ggtattggtg attacaacat agaatgtacc      6720
     cccggtgtta gaaatattat atcgtttgaa caattatcac gtgacttcaa tctggatttg      6780
     gatttatcag atgggaggaa acaaaatttt aattttcatc atccctcagg tttttattca      6840
     ggaaaagtta tgagcataac gcaaaagggt ataaatgcgg ttgttggtac taaactggga      6900
     tatgataaga ttcgtggtaa taatcttgat aatacctttt ctcttgggag tggaggaggt      6960
     gttatatatt ctggaggagg gagcaatacc tatttcgttc ccgccacact acaggataat      7020
     ttacacatat atatatcaga aaaatcaaat ggcaatcata ttatattagg tgatatgcac      7080
     tctcgcctat ctattgaatg ccactttagt aataatgaaa gagagtttat aaagatgggc      7140
     tactataatg gatgtgatgt gattttagaa agtgacacta tacaaaaaat aaaatcattt      7200
     gcaaaaaata taacaataca gacagcggat ggagttatgg caaattggga tgataaacta      7260
     aatactctgt ctgtttattc aatagatatg attgcatgga gggataaaaa taaaactgca      7320
     aaagaaccgt taccagttga tgtaatccag ttaactaatt ggaggatgca taacacatgc      7380
     tctttatttt atgataaata tcaagttgat attgaagcca ataagttaac gtatacagtc      7440
     ttatttcctg atacggagtt acccgttcag ctcaattata ccagtattat ttatggtaat      7500
     catggggcaa aatacacctt cctcaattca ggaagtaaaa ctatagatat tcacattctt      7560
     gataaaaata gtgattatga tacttttgac ttccgtaata ttatttttga acattacacc      7620
     aatgagatat ttataagttt tgataatcaa ggaggatttg ttatatcaat attaaataat      7680
     gctacgagtg aagcggcgaa cattaatgta ttccgaaaaa acatgacttc tttagatagt      7740
     agtggttcat tgatatattt gcctagcggt gatatttatc atatttcaga tatctataaa      7800
     atgtccagag gtagaaaatc gtttaaatta aatgtagaaa agaaacctga cattgatgat      7860
     atcatcaatg tggctatttt agaaacttct tatctacaaa taaaaaaaat ccccaataat      7920
     gatgatagtg attatatttt atgtttagac aaccctaacc tctcatctta cacattgaac      7980
     tttaatgact tgtctggata catatcaagt ttatgggata atattagggg tagttttacc      8040
     ccttttcata aaaatactgt aaacatcgcc cctaatgaaa aaaaatatat ttccctaatc      8100
     ggacttgata agttgtcatt caatattgat gtttttagac aagcattaga ggtaaaaaat      8160
     aagaatagtt acaagataag taaatttaca tgggaaacgt atggtgatat cgttgtatca      8220
     cctgaagata gaatttctca tctggagtta gatgggttta attatttttc acaacccgag      8280
     ttagatactc caatatctga ctcattttca tatttatatg ataattttca gatcgttgat      8340
     agtgatgtgc atattaagct tcttcatctc aacagagaaa caaagcaaat aacaccacat      8400
     cgtattattc ttaaaagata ctttatagac tcatttgcta aaacaagtat cactgacaga      8460
     gaaaagaata tatatcctgt gatttgtgat tcacctgatc acttcacaag cgacatatat      8520
     aggcatccat ttagaatagt tctcgggaat aagacattgt atccatcaga agaacttgta      8580
     aaattcataa gcacctcaaa agaatattta agcaatatgg atgtgattaa caatgttatt      8640
     gttcctcaaa aaacaacaaa gaaaaacaaa ttatccatag ttagtttaaa tagcaatatc      8700
     aaaaatgata ttgtattgtc cggagtaatg accggaacat caaagatttt tcatctaaat      8760
     aattcaggtg atttattgtt aacaacctca aaaactcatg gtggtggggt tgtggttatt      8820
     tttaaagatt ttataaataa ctggtggaaa tataatctta ctttaataac agttcctatt      8880
     gataataaat tgtcagacaa tagaataaat ataaccccaa tggggataaa gatacaggaa      8940
     acagtcagtg gaaatgacag gttgtttttt taccctactc cattaaaaaa tggatgtttt      9000
     atcttgcata atccacttta ctctaactca ttcccttctt tatattcaca tgaattattt      9060
     gatttgattg aagcatatag aaatccaacg tattcgtatt tacagaacaa tattatcaat      9120
     agatatatac atactgtttc tgagtatgct ggaaaagacg gtattgccaa tatgtcatta      9180
     tctatatacg catactcgac atgtcgtttc tggtcaaaag aaagtgtggc tgtaggagat      9240
     acaataaaat tgtctaatta tgagcatatt gagtttagct ttaattcatt tagtaaggat      9300
     tactttcgtg aacaaaatag tgatatatat aaaatatttt ttaaaattgc ttcttcgagt      9360
     aattcggttg ttgtggataa aaatacgctc actcaaaaaa acttcctaga aaacaataca      9420
     tttttcagta ttacaggtat agatgagtct ctctatgaaa agcatataat ctttatcact      9480
     cttaaggtta ttgtcccctc aaaaaagtag                                       9510
//

If you have problems or comments...

PBIL Back to PBIL home page