(data stored in SCRATCH zone)

EMBL: CP001163.PE53

CP001163.PE53        Location/Qualifiers
FT   CDS_pept        complement(49333..49836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0077"
FT                   /product="putative transposase family protein"
FT                   /note="identified by match to protein family HMM PF01527;
FT                   match to protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34526"
FT                   /protein_id="ACI34526.1"
FT                   /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWAAICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGSGDGGLTTAERQRLKELERENRELRVQFFRLLNRRYEKASIILTS
FT                   NKGFADWGEMFGEHVLATAILDRLLHHSTTLNIKGESYRFNIPDRLVVHLSLHARPELR
FT                   AHNT"
     atgactaaaa atactcgttt ttcccccgag gtccgtcaac gggcagttcg tatggttctg        60
     gaaagtcagg gcgaatatga ctcacaatgg gcggcaattt gttccattgc cccaaagatt       120
     ggctgtacac cagagactct gcgtgtgtgg gttcgtcagc atgagcggga taccgggagt       180
     ggtgatggtg gactcaccac cgctgaacgt cagcgtctga aagagctgga acgtgaaaat       240
     cgtgaactgc gcgttcagtt cttccggcta ctgaaccgtc gatatgaaaa agcgagcatc       300
     atactgacgt caaacaaagg gttcgcagac tggggagaaa tgttcggaga gcatgtgctg       360
     gcaacagcga tcctggaccg gctgctacat cactcaacca cgctgaatat caaaggagag       420
     agttaccggt tcaatattcc agacagactc gtggttcatt tgagcctcca tgctcgccct       480
     gaactccggg cacacaatac gtga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page