(data stored in SCRATCH zone)

EMBL: CP001163.PE54

CP001163.PE54        Location/Qualifiers
FT   CDS_pept        49983..51281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0079"
FT                   /product="protein TraI"
FT                   /note="identified by match to protein family HMM PF07057"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34506"
FT                   /protein_id="ACI34506.1"
FT                   /translation="MAEGVTLYPPDTIRVGTGDRMRFTKSDRGRGYVANSVWTVTAVSG
FT                   DSVTLSGGQQTRVIRPAQERAEQHIDLAYAITAHGAQGASETFAIALEGTEGSRKLMAG
FT                   FESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVFEPKPDREVMNAERLFST
FT                   ARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAGIWLNPL
FT                   TTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVV
FT                   RIAGEGRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERR
FT                   ADEIVRKMAENKPDLPDGRTEQAVREIAGQERERAVTSEREAALPESVLREPQREREAV
FT                   REVVRENLLQERLQQMERDMVRDLQKEKTLGGD"
     gtggctgaag gcgtcacact gtaccccccg gacaccatca gggtggggac cggtgaccgg        60
     atgcgcttca cgaagagtga ccgggggcgt ggttatgtgg ccaacagcgt ctggacggtg       120
     acagcggttt ccggtgacag tgtcacgctg tcgggcggac agcagacccg ggtgattcgc       180
     cccgcccagg agcgggcaga gcaacatatt gacctggcct atgccatcac cgctcacggt       240
     gcgcaggggg caagtgaaac ctttgccatc gcgcttgaag gtacggaagg cagccggaaa       300
     ctgatggccg gctttgagtc agcctacgtg gccctgtcgc gtatgaagca gcatgtgcag       360
     gtgtacaccg ataaccgtca gggctggacg gatgccatta acaatgccgt acagaaagga       420
     acagcccacg atgtgtttga accgaaaccg gaccgggagg tcatgaatgc agagcggctg       480
     ttcagtacgg cgcgggagct gcgggacgtg gcggcagggc gtgccgttct tcgtcaggcg       540
     gggcttgccg ggggagacag tcctgcacgg tttattgctc cgggacgtaa atatccacag       600
     ccgtatgtgg cactgccggc gtttgaccgt aacggcaagt ctgccggtat ctggctgaac       660
     ccgctgacca cggatgacgg aaacgggctg cggggattca gtggtgaagg acgggtgaaa       720
     ggcagcgggg atgcgcagtt cgtggccctg cagggcagcc gtaacggaga gagcctgctg       780
     gctgataata tgcaggatgg tgtccggatt gcccgtgata atcctgacag cggtgtggtg       840
     gtgagaatcg ccggtgaagg tcgtccgtgg aatcccggtg ccatcaccgg tggtcgcgtg       900
     tggggggata tcccggacaa cagcgtccag ccgggagccg gaaatggcga gccggtcacg       960
     gcagaggtac tggcacagcg gcaggctgaa gaggccatcc gccgtgaaac ggaacgccgc      1020
     gcagatgaaa ttgtccgtaa aatggcagag aacaaacctg acctgccgga cggcagaaca      1080
     gagcaggctg tcagggagat tgccgggcag gagcgtgaac gggctgtcac ttctgaacgg      1140
     gaagccgcgc tgccggagag tgtactgcgt gaaccacaac gggagcggga ggcggtccgt      1200
     gaggttgtcc gggaaaacct gctgcaggag cgactgcagc agatggagcg ggatatggtt      1260
     cgtgacctgc agaaagagaa aaccctgggc ggagactga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page