(data stored in SCRATCH zone)

EMBL: CP001163.PE56

CP001163.PE56        Location/Qualifiers
FT   CDS_pept        52106..52966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0081"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34467"
FT                   /protein_id="ACI34467.1"
FT                   /translation="MKITDHKLSEGIALTFRVPEGNIKHPLIILCHGFCGIRNVLLPCF
FT                   ANAFTEAGFATITFDYRGFGESDGERGRLVPAMQTEDIISVINWAEKQECIDNQRIGLW
FT                   GTSLGGGHVFSAAAQDQRVKCIVSQLAFADGDVLVTGEMNESERASFLSTLNKMAEKKK
FT                   NTGKEMFVGVTRVLSDDESKVFFEKIKARHPEMDIKIPFLTVMETLQYKPAESAASVQC
FT                   PVLVVIAGQDSVNPPEQGRALYDAVASGTKELYEEADACHYDIYEGAFFERVVAVQTQW
FT                   FKQYL"
     atgaaaatta cggatcacaa actctctgaa ggtattgccc tgacatttcg tgttcctgaa        60
     ggaaatataa aacatccttt gattatctta tgccatgggt tttgcggtat caggaatgtt       120
     ctgctccctt gctttgcgaa tgccttcaca gaagcaggat tcgcaacgat tacttttgat       180
     tatcgaggat tcggtgagag tgatggagaa cgagggcgtc tggttcctgc aatgcagacc       240
     gaagatatta tttcagttat caattgggca gaaaagcagg aatgtattga taatcagcgt       300
     attgggttat ggggaacatc gctgggaggg gggcatgtct tcagtgcagc tgcgcaggac       360
     caacgcgtaa aatgtattgt cagccagctg gcttttgctg acggtgatgt tctggttacc       420
     ggagagatga atgaatcgga gagagcgtct tttctatcca cgctgaataa aatggcagag       480
     aagaagaaaa acaccgggaa agagatgttt gtgggggtta cacgggtact aagtgatgat       540
     gaatcgaagg tattcttcga gaaaatcaaa gcccggcatc ccgaaatgga tataaaaata       600
     cctttcctta cggtcatgga aacgttgcaa tataaaccgg cagagagtgc agccagcgtc       660
     cagtgcccag ttttggttgt tattgccggc caggatagcg ttaatccacc ggaacaggga       720
     agagcattat atgatgctgt tgcttctggt actaaggaat tatacgagga agctgatgca       780
     tgccattatg atatttatga gggcgcgttt tttgaacgtg tagtagctgt gcagacacaa       840
     tggtttaaac aatatcttta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page