(data stored in SCRATCH zone)

EMBL: CP001163.PE59

CP001163.PE59        Location/Qualifiers
FT   CDS_pept        54219..54680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0084"
FT                   /product="nuclease homolog"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34505"
FT                   /protein_id="ACI34505.1"
FT                   /translation="MRKYIPLVLFIFSWPVLCADIHGRVVRVLDGDTIEVMDSRKVVRI
FT                   RLVNIDAPEKKQDYGRWSTDMMKSLVAGKTVTVTYFQRDRYGRMLGQVYAPDGMNVNQF
FT                   MVRAGAAWVYEQYNTDPVLPVLQNEARQQKRGLWSDADPVPPWIWRHRK"
     atgaggaaat atattccact ggtattattt atcttttcat ggccggtatt gtgtgcagat        60
     attcatggac gggttgttcg tgtactggac ggtgatacca tcgaggtcat ggactcacgg       120
     aaggtggtgc ggatcaggct ggtaaatatt gatgcgccgg aaaagaaaca ggattatggc       180
     cggtggtcga cagacatgat gaaatcactg gttgcaggaa aaacggttac cgtcacatat       240
     tttcagcgag atcgttatgg tcgtatgctc gggcaggttt atgcaccaga cggaatgaat       300
     gttaatcagt ttatggtccg ggccggggcc gcctgggtat atgagcagta caacacagat       360
     cccgtgctgc ctgtccttca gaacgaagcc agacaacaaa aacgtgggct ctggtcagat       420
     gctgatccgg ttcccccctg gatatggaga caccgtaaat aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page