(data stored in SCRATCH zone)

EMBL: CP001163.PE6

CP001163.PE6         Location/Qualifiers
FT   CDS_pept        8417..9157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0024"
FT                   /product="site-specific recombinase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34436"
FT                   /protein_id="ACI34436.1"
FT                   /translation="MNNVIPLQNSPERVFLLPIAPGVDFATALSLRRMATSTGATPAYL
FT                   LAPEVSALLFYMPDQRHHMLFATLWNTGMRIGEARMLTPESFDLDGARPFVRILSEKVR
FT                   ARRGRPPKDEVRLVPLTDISYVRQMESWMITTRPRRREPLWAVTDETMRNWLKQAVRRA
FT                   EADGVHFSIPVTPHTFRHSYIMHMLYHRQPRKVIQALAGHRDPRSMEVYTRVFALDMAA
FT                   TLAVPFTGDGRDAAEILRTLPPLR"
     atgaacaatg tcattcccct gcagaattca ccagaacgcg tcttcctgtt acccattgcg        60
     ccgggggtgg attttgcaac agcgctctcc ctgagaagaa tggccacttc cacaggggcc       120
     acaccggcct acctgctggc cccggaagtg agtgcccttc ttttctatat gccggatcag       180
     cgtcaccata tgctgttcgc caccctctgg aataccggaa tgcgtattgg cgaagcccgg       240
     atgctgacgc cggaatcatt tgacctggat ggagcaaggc cgtttgtgcg gatcctgtcc       300
     gaaaaagtgc gtgcgcgacg cggacgcccg ccaaaagatg aagtccgcct ggttccgctg       360
     acggatataa gctatgtcag gcagatggaa agctggatga tcaccacccg gccccgtcgt       420
     cgtgaaccat tatgggccgt gaccgacgaa accatgcgca actggctgaa gcaggctgtc       480
     agacgggccg aagctgacgg agtacacttt tcgattccgg tcacaccaca caccttccgg       540
     cacagctata tcatgcatat gctctatcac cgccagcccc ggaaagtcat ccaggccctg       600
     gcaggtcaca gggatccacg ttcgatggag gtttatacca gagtgtttgc gctggatatg       660
     gctgccacgc tggcagtgcc tttcacaggt gacgggcggg atgctgcgga gatcctgcgt       720
     acactgcctc ccctgaggtg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page