(data stored in SCRATCH zone)

EMBL: CP001163.PE60

CP001163.PE60        Location/Qualifiers
FT   CDS_pept        54726..54935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05321"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34499"
FT                   /protein_id="ACI34499.1"
FT                   /translation="MEKTKQEWLYQLRRCSSVNTLEKIIHKNRDSLSTSERESFNSAAD
FT                   HRLAELITGKLYDRIPKEIWKYVR"
     atggaaaaaa caaaacagga atggctgtat caattacggc gatgttcatc agtcaatacg        60
     ctggaaaaaa ttattcataa aaacagagac agtttatcga ccagtgaacg tgaatcattt       120
     aattcagcag cagaccaccg gttagcagaa ttaatcaccg gaaagttata tgacaggata       180
     ccaaaagaaa tatggaaata tgtaaggtaa                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page