(data stored in SCRATCH zone)

EMBL: CP001163.PE62

CP001163.PE62        Location/Qualifiers
FT   CDS_pept        55551..55805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0087"
FT                   /product="replication regulatory protein repA2"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34463"
FT                   /protein_id="ACI34463.1"
FT                   /translation="MSQTENAVTSSSGAKRAYRKGNPLSDAEKQRLSVARKRASFKEVK
FT                   VFLEPKYKAMLMQMCHEDGLTQAEVLTALIKSEAQKRCV"
     atgtcgcaga cagaaaatgc agtgacttcc tcatctggcg caaaacgagc atacagaaag        60
     gggaatccgc tttctgatgc agagaaacaa agattatcag tggcccgtaa aagagcttcg       120
     ttcaaggaag taaaagtatt tcttgaacca aagtataagg ccatgctcat gcaaatgtgt       180
     catgaagatg gcctgactca ggctgaagtt ctgaccgcac tgataaaaag tgaagcgcaa       240
     aaacgatgtg tgtga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page