(data stored in SCRATCH zone)

EMBL: CP001163.PE65

CP001163.PE65        Location/Qualifiers
FT   CDS_pept        complement(57282..57434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0091"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34441"
FT                   /protein_id="ACI34441.1"
FT                   /translation="MWFQFCAGPGFFWRLFLCVVTKVAPVGARRLRWEVHICLSTGQAV
FT                   NKSFF"
     ttgtggtttc agttctgcgc gggaccgggg tttttctgga ggttgttttt gtgtgttgta        60
     actaaagtgg ctccggttgg ggcccgccgc ttgcggtggg aggtgcatat ctgtctgtcc       120
     acaggacagg cagtgaataa gtcttttttt taa                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page