(data stored in SCRATCH zone)

EMBL: CP001163.PE66

CP001163.PE66        Location/Qualifiers
FT   CDS_pept        57878..58162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0092"
FT                   /product="CopG family protein"
FT                   /note="identified by match to protein family HMM PF01402"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34433"
FT                   /protein_id="ACI34433.1"
FT                   /translation="MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQAL
FT                   SAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAWADSLSTDNPLPVPR"
     atgcaaatga aaaacaatac cgcacaagca acaaaagtca ttaccgcgca tgtgccatta        60
     cctatggctg ataaagtcga ccagatggcc gccagactgg aacgctcccg gggttgggtt       120
     atcaaacagg cgctttctgc atggcttgcc caggaggagg agcgtaatcg cctgacgctg       180
     gaagccctgg acgatgtgac atccggacag gttattgacc atcaggctgt acaggcctgg       240
     gcggacagcc tcagtactga caatccgtta ccggtgccac gctga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page