(data stored in SCRATCH zone)

EMBL: CP001163.PE67

CP001163.PE67        Location/Qualifiers
FT   CDS_pept        58162..58437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0093"
FT                   /product="plasmid stabilization system protein, RelE/ParE
FT                   family"
FT                   /note="identified by match to protein family HMM PF05016"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34508"
FT                   /protein_id="ACI34508.1"
FT                   /translation="MELKWSSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTH
FT                   PRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIYVLRLWHTRENR"
     atggaactga agtggagcag taaagcgctt tctgatttgg cgcggttata tgattttctg        60
     gtgctagcca gtaaacctgc tgccgccaga acggtacagt ccctgacaca ggcaccggtc       120
     attctgttaa ctcatccacg tatgggggaa cagttatttc agtttgaacc cagggaggtc       180
     agacggattt ttgctggcga gtacgaaatc cgttacgaac ttaatggcca gactatttat       240
     gtattgcgcc tgtggcacac acgagaaaac aggtag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page