(data stored in SCRATCH zone)

EMBL: CP001163.PE69

CP001163.PE69        Location/Qualifiers
FT   CDS_pept        complement(58823..59044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0095"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34449"
FT                   /protein_id="ACI34449.1"
FT                   /translation="MIPDALAAEGSSKRDWNRFLDSHYRRGWNVNVSRVMDNATHVAVY
FT                   FGSYLKKPPVPMSRLEHYAGQDEIDPFN"
     gtgataccgg atgcgctggc agcagaagga agcagtaaac gggactggaa tcgcttcctg        60
     gacagtcatt accggcgggg ctggaatgtc aacgtatccc gggtgatgga taacgccaca       120
     catgtggcgg tgtacttcgg ctcttacctg aaaaaaccgc cggtgccgat gagccgtctg       180
     gagcactatg ctggtcagga tgaaatagat ccatttaatt ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page