(data stored in SCRATCH zone)

EMBL: CP001163.PE70

CP001163.PE70        Location/Qualifiers
FT   CDS_pept        complement(59097..59831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0096"
FT                   /product="ISSd1, transposase OrfB"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34451"
FT                   /protein_id="ACI34451.1"
FT                   /translation="MDTVSAESGSRLSVAAYCVHTSLPVLVPGVPQPVVTGRDEPHCCG
FT                   CDTGNLPPGRCATTNSNHNLPVAPNLLNQTFAPAAPNQVWVADLTYVATQEGWLYLAGI
FT                   KDVYTCEIVGYAMGERMTKELTGKALFMALRSQRPPAGLIHHSDRGSQYCAYDYRVIQE
FT                   QFGLKTSMSRKGNCYDNAPMESFWGTLKNESLSHYRFNNRDEAISVIREYIEIFYNRQR
FT                   RHSRLGNISPAAFREKYHQMAA"
     gtggatacag tatctgctga gtctggttcc cgactgtccg tggcagcata ttgtgttcac        60
     acttccctgc cagtactggt ccctggtgtt ccacaaccgg tggttactgg cagagatgag       120
     ccgcattgct gcggatgtga tacaggaaat ctgccgccag gcagatgtgc gactacgaac       180
     tcgaaccaca atctgccagt tgcgccaaat ctgctgaacc agacgttcgc tcctgcagca       240
     ccaaatcagg tctgggtggc ggacctgacg tatgttgcca cacaggaggg atggttgtac       300
     ctcgctggca tcaaagatgt ttatacgtgc gaaattgtcg gctacgccat gggagagcgc       360
     atgacaaaag agctgacagg taaagccctg tttatggcgc tcaggagcca gcgcccacct       420
     gccgggctaa tccaccactc tgatcgaggt tcacagtact gcgcatacga ttaccgggtc       480
     atacaggagc agtttggtct gaaaacatca atgtcgcgta aaggtaactg ttacgacaac       540
     gctccgatgg aaagcttctg gggaacgctg aaaaatgaga gcctgagcca ctatcgtttt       600
     aataaccggg atgaagccat ctcagtaata cgggaataca ttgagatttt ctacaatcgt       660
     cagcgtcgtc actctcgtct ggggaatatc tccccggcag ccttcaggga aaaatatcat       720
     cagatggctg cttaa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page