(data stored in SCRATCH zone)

EMBL: CP001163.PE74

CP001163.PE74        Location/Qualifiers
FT   CDS_pept        62695..63084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0100"
FT                   /product="cytochrome b562 family protein"
FT                   /note="identified by match to protein family HMM PF07361"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34493"
FT                   /protein_id="ACI34493.1"
FT                   /translation="MQKSNKVIISCGMALYFLCGGITVAEELDESMQVLARNMSVLQSS
FT                   MDKKELLEALDRMDDAVDESMKRLPESISPADEEGKNDYIKELQKLEKEIMLAKQKVLS
FT                   GQLSDIPDSVNKMNKIRVEGHDKFR"
     atgcagaaaa gcaataaagt tataatcagc tgtggtatgg cattatattt tttgtgtggg        60
     gggattacag tggcagaaga acttgatgaa agcatgcaag ttcttgcaag gaatatgagt       120
     gtacttcagt catcaatgga taaaaaggag cttcttgaag ctcttgacag aatggatgat       180
     gctgtagatg agtcaatgaa gcgtcttcct gagagcattt caccggctga tgaagaaggg       240
     aagaatgact atataaaaga acttcaaaag cttgaaaaag agattatgct ggcgaaacaa       300
     aaagtcttat cgggacagtt atcagatata cccgattcgg taaacaagat gaataaaatc       360
     agagttgagg ggcatgataa attcagataa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page