(data stored in SCRATCH zone)

EMBL: CP001163.PE76

CP001163.PE76        Location/Qualifiers
FT   CDS_pept        63242..64129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0102"
FT                   /product="IS629, transposase orfB"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34450"
FT                   /protein_id="ACI34450.1"
FT                   /translation="MPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARAQ
FT                   RDDWLKREIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKKI
FT                   RTTVSRKAVSAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGCIVGWR
FT                   VSSSMETTFVLDALEQALWARRPSGTVHHSDKGSQYVSLAYTERLKEAKLLASTGSTGD
FT                   SYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLGRLGHIPPAEAE
FT                   KAYYASIRNDDLAA"
     atgccactgc tggataagct gcgtgagcag tacggggtcg gaccggtatg cagtgagctg        60
     catattgccc cgtcaacgta ttaccactgt cagcaacagc gacatcatcc tgataaacgc       120
     agtgcccgtg ctcagcgcga tgactggctg aagagagaga tacagcgcgt atacgatgaa       180
     aatcatcagg tgtacggtgt gcgtaaagtc tggcgccagt tgttacgcga aggtatcagg       240
     gtggccagat gtacagtggc gcgcctcatg gcggttatgg gacttgccgg tgttctccgg       300
     ggtaaaaaga tccgtactac cgtcagccgg aaagccgttt ccgcaggcga ccgcgtaaac       360
     cgtcagttcg tggcagaacg tcctgaccag ctgtgggtgg ctgattttac ttacgtcagc       420
     acatggcagg gcttcgtcta tgtggcgttc atcattgatg tgtttgccgg atgtatcgtg       480
     gggtggcggg tctcatcgtc tatggaaacg acattcgtgc tggatgcact ggagcaggcg       540
     ttgtgggccc gtcggccgtc cggcacagtc catcacagtg ataaaggttc tcagtatgta       600
     tcactggcct atacggagcg actaaaagaa gcaaaactgc tggcatcaac agggagtaca       660
     ggtgactcgt atgacaacgc gatggcggag agcatcaatg gtctttacaa agcggaggta       720
     atacaccgta agagctggaa aaaccgtgca gaagtggaac tggccacact cacgtgggtg       780
     gactggtata acaatcgacg attgctggga aggctgggtc atatccctcc ggcagaagca       840
     gaaaaagctt attatgcttc catcagaaac gatgatctgg cagcctga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page