(data stored in SCRATCH zone)

EMBL: CP001163.PE77

CP001163.PE77        Location/Qualifiers
FT   CDS_pept        complement(64132..64272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34496"
FT                   /protein_id="ACI34496.1"
FT                   /translation="MYQRCVSDSREHCNHRPDKCLLLYVFVIIRITNTEPPRFSWRVFY
FT                   L"
     atgtatcaga ggtgtgtctc tgacagtcgt gaacattgta atcatcgtcc agataaatgt        60
     ttactccttt atgtgtttgt tatcatacgg ataacaaaca ctgaaccgcc ccggttttcc       120
     tggagagtgt tttatctgtg a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page