(data stored in SCRATCH zone)

EMBL: CP001163.PE78

CP001163.PE78        Location/Qualifiers
FT   CDS_pept        64310..68212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0104"
FT                   /product="immunoglobulin A1 protease domain protein"
FT                   /note="identified by match to protein family HMM PF02395;
FT                   match to protein family HMM PF03797; match to protein
FT                   family HMM TIGR01414"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34461"
FT                   /protein_id="ACI34461.1"
FT                   /translation="MNKIYSLKYSHITGGLIAVSELSGRVSSRATGKKKHKRILALCFL
FT                   GLLQSSYSFASQMDISNFYIRDYMDFAQNKGIFQAGATNIEIVKKDGSTLKLPEVPFPD
FT                   FSPVANKGSTTSIGGAYSITATHNTKNHHSVATQNWGNSTYKQTDWNTSHPDFAVSRLD
FT                   KFVVETRGATEGADISLSKQQALERYGVNYKGEKKLIAFRAGSGVVSVKKNGRITPFNE
FT                   VSYKPEMLNGSFVHIDDWSGWLILTNNQFDEFNNIASQGDSGSALFVYDNQKKKWVVAG
FT                   TVWGIYNYANGKNHAAYSKWNQTTIDNLKNKYSYNVDMSGAQVATIENGKLTGTGSDTT
FT                   DIKNKDLIFTGGGDILLKSSFDNGAGGLVFNDKKTYRVNGDDFTFKGAGVDTRNGSTVE
FT                   WNIRYDNKDNLHKIGDGTLDVRKTQNTNLKTGEGLVILGAEKTFNNIYITSGDGTVRLN
FT                   AENALSGGEYNGIFFAKNGGTLDLNGYNQSFNKIAATDSGAVITNTSTKKSILSLNNTA
FT                   DYIYHGNINGNLDVLQHHETKKENRRLILDGGVDTTNDISLRNTQLSMQGHATEHAIYR
FT                   DGAFSCSLPAPMRFLCGSDYVAGMQNTEADAVKQNGNAYKTNNAVSDLSQPDWETGTFR
FT                   FGTLHLENSDFSVGRNANVIGDIQASKSNITIGDTTAYIDLHAGKNITGDGFGFRQNIV
FT                   RGNSQGETLFTGGITAEDSTIVIKDKAKALFSNYVYLLNTKATIENGADVTTQSGMFST
FT                   SDISISGNLSMTGNPDKDNKFEPSIYLNDASYLLTDDSARLVAKNKASVVGDIHSTKSA
FT                   SIMFGHDESDLSQLSDRTSKGLALGLLGGFDVSYRGSVNAPSASATMNNTWWQLTGDSA
FT                   LKTLKSTNSMVYFTDSANNKKFHTLTVDELATSNSAYAMRTNLSESDKLEVKKHLSGEN
FT                   NILLVDFLQKPTPEKQLNIELVSAPKDTNENVFKASKQTIGFSDVTPVITTRETDDKIT
FT                   WSLTGYNTVANKEATRNAAALFSVDYKAFLNEVNNLNKRMGDLRDINGEAGAWARIMSG
FT                   TGSASGGFSDNYTHVQVGVDKKHELDGLDLFTGFTVTHTDSSASADVFSGKTKSVGAGL
FT                   YASAMFDSGAYIDLIGKYVHHDNEYTATFAGLGTRDYSTHSWYAGAEAGYRYHVTEDAW
FT                   IEPQAELVYGSVSGKQFAWKDQGMHLSMKDKDYNPLIGRTGVDVGKSFSGKDWKVTARA
FT                   GLGYQFDLLANGETVLRDASGEKRIKGEKDSRMLMSVGLNAEIRDNVRFGLEFEKSAFG
FT                   KYNVDNAVNANFRYSF"
     atgaataaaa tatactctct taaatacagc catattacag gagggttaat cgctgtttct        60
     gaattatccg gcagagtatc atcaagagca actggtaaga aaaaacacaa acgcatactt       120
     gcattatgtt ttttaggctt attacaatcc tcatattctt ttgcgtcaca gatggatatt       180
     tcaaatttct acatccgtga ctatatggat tttgcacaga acaagggcat atttcaggct       240
     ggcgcaacaa atattgaaat agtgaagaaa gatggctcca ccctgaaact accggaagta       300
     ccatttcctg acttctcacc ggttgcaaac aaagggtcaa ccacatctat tggtggtgca       360
     tacagtatca cagccacaca caatacgaaa aaccaccact cagttgcgac gcaaaactgg       420
     gggaacagca cgtacaaaca aactgactgg aatacttcac atcctgattt tgcagtatcc       480
     cgacttgaca agtttgttgt tgagacccga ggtgcgactg aaggcgcaga tatttcgtta       540
     tcaaaacagc aggcacttga acgttacggg gttaattata aaggagaaaa gaaacttatc       600
     gcattcagag ccggctctgg tgtggtatcc gttaaaaaaa atggacgcat aactccattt       660
     aatgaggttt cttataagcc agaaatgtta aatggctctt tcgttcacat tgatgactgg       720
     agtggatggc tgatattaac caacaaccag tttgatgagt ttaataacat tgcctctcag       780
     ggtgacagcg gttcagcact gttcgtctat gataaccaaa agaaaaagtg ggttgtcgct       840
     ggaactgtct gggggattta taattacgcc aatggcaaaa accacgcagc atacagtaaa       900
     tggaaccaga caaccattga caacctgaag aacaagtatt cttacaacgt ggatatgtca       960
     ggggctcagg ttgcaaccat tgaaaatgga aaactgacag gcactggctc agacaccacc      1020
     gatataaaaa ataaggactt aatatttact ggcggtggag atatcctcct gaaatcctct      1080
     tttgataatg gtgctggcgg tcttgtcttt aatgataaaa agacctatcg agtaaacggg      1140
     gatgatttca cctttaaagg tgccggtgtt gatacaagaa acggcagcac cgttgagtgg      1200
     aatatccggt atgataataa agacaacctt cacaaaattg gtgatggcac attagatgtc      1260
     cgaaaaaccc agaacaccaa cctgaaaaca ggtgagggtc ttgtcattct tggagctgaa      1320
     aaaacattca ataatatcta cataaccagt ggtgatggaa ctgtccgact gaatgcagaa      1380
     aatgcactgt ctggcggtga atacaacggt attttctttg cgaaaaatgg cggaactctt      1440
     gacctgaacg gatataatca gtctttcaat aaaattgctg caactgattc aggtgctgta      1500
     ataaccaata cgtcaaccaa aaaatccatt ttatccctga ataatactgc tgactatatc      1560
     tatcacggca acataaacgg gaatctggac gtacttcagc atcatgagac gaaaaaagag      1620
     aaccgtcgtc ttattcttga tgggggcgtg gacacaacaa atgatataag cctgcgtaat      1680
     acacaactgt ccatgcaggg acatgccact gaacatgcca tttatcggga tggagctttc      1740
     tcttgttcac taccagctcc tatgcgcttt ttgtgtggca gtgattatgt tgcaggaatg      1800
     caaaatacag aagctgatgc tgtaaaacaa aacggaaatg cctataaaac caacaatgct      1860
     gtctctgatt tatcgcagcc agactgggaa accggaacat tcagatttgg aacgctacat      1920
     cttgaaaatt ccgatttttc tgttggtcgt aatgcaaatg taatcgggga cattcaggcc      1980
     agtaaatcaa acattactat tggtgacact acagcatata ttgatttgca tgctggtaaa      2040
     aatattaccg gtgatggttt tggcttccgc cagaatattg tgcgtggaaa ctcacaagga      2100
     gaaacgctgt ttacaggagg gatcacagca gaagacagca ctatcgttat taaagataaa      2160
     gcaaaagcat tattttcaaa ttatgtatac ctgctgaaca caaaagcaac catagagaac      2220
     ggtgctgatg tgacaactca aagtggtatg ttctccacga gcgatatcag catctctggt      2280
     aatctgtcca tgacaggcaa tcccgacaaa gacaataaat tcgagccctc aatatatctg      2340
     aatgatgctt cttatctact gactgacgac tccgccagac tcgttgccaa aaataaagca      2400
     tctgtggtgg gagatataca ctccactaaa agtgcatcca tcatgtttgg tcatgatgaa      2460
     agcgacctct cgcagttgtc tgacagaacc tcaaaagggc ttgcacttgg tcttttaggt      2520
     ggctttgatg tctcatatcg cggttcagtc aatgccccgt cagcatctgc cactatgaac      2580
     aacacctggt ggcaactaac cggagattct gcgctgaaaa cactgaaaag tacaaacagc      2640
     atggtctatt tcactgacag cgcaaacaat aagaaattcc atacgctgac ggtcgatgag      2700
     ctggcaacca gcaacagcgc ctatgcgatg cgtacaaacc tttctgaatc agacaaactg      2760
     gaggtcaaaa aacacttgtc tggtgagaac aatattttac tcgttgattt ccttcagaaa      2820
     ccaacgcctg aaaaacaact gaatattgaa ctggtaagcg cgccaaaaga caccaatgaa      2880
     aatgtcttta aagccagtaa acaaaccatt ggtttcagtg atgtaacgcc ggtcattaca      2940
     accagggaaa ccgatgacaa aataacatgg tcactgacag gctataacac ggtagcaaac      3000
     aaggaagcaa cccggaatgc cgccgccctg ttctctgttg actataaagc gtttctgaac      3060
     gaggtcaaca acctgaacaa acgtatgggt gacctgcgtg atatcaacgg cgaagccggt      3120
     gcatgggcac gcatcatgag cggtaccggc tctgccagtg gtggtttcag tgacaactac      3180
     acgcacgttc aggtcggggt cgacaaaaaa cacgagctgg acggactgga tttgtttacc      3240
     ggtttcactg tcacacacac tgacagcagt gcctccgccg atgttttcag tggtaaaacg      3300
     aagtctgtgg gggctggcct gtatgcttcc gccatgtttg attccggtgc ctatatcgac      3360
     ctgattggca agtatgttca ccatgataat gagtacactg caacctttgc cggactcgga      3420
     acccgtgatt acagcacgca ttcatggtat gccggtgcag aagcgggcta ccgctatcat      3480
     gtcactgagg atgcctggat tgagccacag gctgagctgg tttacggttc tgtatccggt      3540
     aaacagtttg catggaagga ccagggaatg catctgtcca tgaaggacaa ggactacaat      3600
     ccgctgattg gccgaacggg tgtggatgtg ggtaaatcct tctctggtaa ggactggaaa      3660
     gtgacagccc gtgccggtct gggctaccag ttcgacctgc tggctaacgg cgaaaccgta      3720
     ttgcgggatg catctggtga aaaacgcatc aaaggtgaaa aggacagccg tatgctgatg      3780
     tccgttggcc tgaatgcaga aatcagggat aacgtccgct ttggactgga gtttgagaaa      3840
     tccgcctttg gtaagtacaa cgttgataat gctgtcaacg ctaatttccg ttactcgttc      3900
     tga                                                                    3903
//

If you have problems or comments...

PBIL Back to PBIL home page