(data stored in SCRATCH zone)

EMBL: CP001163.PE79

CP001163.PE79        Location/Qualifiers
FT   CDS_pept        complement(68375..68515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34468"
FT                   /protein_id="ACI34468.1"
FT                   /translation="MLALLAPFTIGMLTSDKCNLRYLTENVPFAGTGGQSCMQDLYHSS
FT                   G"
     ttgctggcgc tgcttgcccc ttttaccatc ggtatgttaa ccagtgacaa atgtaacctt        60
     cgctatctta ctgaaaatgt gccatttgca ggaaccggcg gtcaatcctg tatgcaggat       120
     ttgtatcaca gttccggatg a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page