(data stored in SCRATCH zone)

EMBL: CP001163.PE8

CP001163.PE8         Location/Qualifiers
FT   CDS_pept        complement(9442..10419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0026"
FT                   /product="initiator RepB protein"
FT                   /note="identified by match to protein family HMM PF01051"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34471"
FT                   /protein_id="ACI34471.1"
FT                   /translation="MDKSSGELVTLTPNNNNTVQPVALMRLGVFVPTLKSLKNSKKNTL
FT                   SRTDATEELTRLSLARAEGFDKVEITGPRLDMDNDFKTWVGIIHSFARHNVIGDKVELP
FT                   FVEFAKLCGIPSSQSSRRLRERISPSLKRIAGTVISFSRTDEKHTREYITHLVQSAYYD
FT                   TERDIVQLQADPRLFELYQFDRKVLLQLKAINALKRRESAQALYTFIESLPRDPAPVSL
FT                   ARLRARLNLKSPVFSQNQTVRRAMEQLREIGYLDYTEIQRGRTKLFCIHYRRPRLKAPN
FT                   DESKENPLPPSPAEKVSPEMAEKLALLEKLGITLDDLEKLFKSR"
     gtggataagt cgtccggtga gctggtgaca ctgacaccaa acaataacaa caccgtacaa        60
     cctgtggcgc tgatgcgtct gggcgttttt gtaccgaccc ttaaatcact gaagaacagt       120
     aaaaaaaata cactgtcacg tactgatgcc acggaagagc tgacacgtct ttccctggcc       180
     cgtgctgagg gattcgataa ggttgagatc accggccccc gcctggatat ggataacgat       240
     ttcaagacct gggtggggat cattcattcc tttgcccgcc ataacgtaat tggtgacaaa       300
     gttgaactgc cttttgtcga gtttgcaaaa ctgtgtggta taccttcaag ccagtcatca       360
     cgcaggctgc gtgagcgcat cagcccttcc ctgaaacgca ttgccggtac cgtgatctcc       420
     ttttcccgca ccgatgagaa gcacacccgg gaatacatca cccatctggt acagtcagcc       480
     tactacgata ctgaacggga tattgttcag ttacaggctg atccccgcct ttttgaactg       540
     taccagtttg acagaaaggt ccttctccag cttaaggcga ttaatgccct gaagcgacgg       600
     gagtccgccc aggcactcta cacctttata gagagcctgc cccgggatcc ggcaccggta       660
     tcgctggcgc ggctgcgtgc acgcctcaat ctgaagtctc ctgtattttc ccagaaccag       720
     acggtcagac gggcaatgga gcagctgcgc gagattggat atcttgatta cacggagatc       780
     cagcgggggc ggacaaaact cttctgcatt cactaccggc gtccccggtt aaaagcaccg       840
     aatgatgaga gtaaggaaaa tccgttgcca ccttcacctg cggaaaaagt cagtccggag       900
     atggcggaga agcttgccct gcttgagaaa ctgggcatca cgctggatga cctggaaaaa       960
     ctcttcaaat cccgctga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page