(data stored in SCRATCH zone)

EMBL: CP001163.PE82

CP001163.PE82        Location/Qualifiers
FT   CDS_pept        complement(69544..69678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0108"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34439"
FT                   /protein_id="ACI34439.1"
FT                   /translation="MITFRVWHFEDSTVQLMNLTRVQIFLLSITCPYLLKVDISLKSC"
     gtgattacgt tccgggtgtg gcactttgaa gacagcactg tgcaacttat gaatctcacc        60
     cgggttcaga tatttttgtt gtccattacc tgtccttatt tattgaaagt cgatattagt       120
     ttaaaaagct gctaa                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page