(data stored in SCRATCH zone)

EMBL: CP001163.PE83

CP001163.PE83        Location/Qualifiers
FT   CDS_pept        complement(70032..70205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0110"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34425"
FT                   /protein_id="ACI34425.1"
FT                   /translation="MLFLIRFSVFQKKQNTAISVNTARDIRLSKKSEDYHPDLLHKTSR
FT                   VAEFSASGYHSP"
     atgctctttt taatcagatt ttctgttttt cagaaaaaac agaataccgc aatttcagta        60
     aacacagcga gagatatccg cctcagtaaa aaatcagaag attatcatcc tgatttattg       120
     cataaaacca gtcgagtagc ggaattttct gcatccggat accactcccc ctga             174
//

If you have problems or comments...

PBIL Back to PBIL home page