(data stored in SCRATCH zone)

EMBL: CP001163.PE84

CP001163.PE84        Location/Qualifiers
FT   CDS_pept        70391..71212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0111"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34498"
FT                   /protein_id="ACI34498.1"
FT                   /translation="MLNARHLPVLMYHHVSRCPGLVTLSPETFCEQMKWLADNNWRTVT
FT                   SAELEYFYQGGTLPRKSVMLTFDDGYLDNWLRAWPVLKEYNLHAHIFLITGLIGKGNVR
FT                   SRQEQEYSHRDCERLIADNRSDEVMLRWSEVREMRDSGLVEFHVHTHSHKRWDRLSVSR
FT                   AEQCRLMKEDILVGKQCLTEKLGFCSSHLCWPEGYYNRDYINLAGKLGFSYLYTTERRM
FT                   NCPENGSLRIGRISTKEREHSGWLKRRLFYYTTPLFSSVLALHKGPRLPDN"
     atgttgaatg caaggcatct tcccgtactg atgtatcatc atgtcagtcg ttgtccgggg        60
     cttgtgacac tctcacctga aacattttgt gaacagatga agtggctcgc agataataac       120
     tggcggacgg taacatctgc tgagcttgaa tatttttatc aggggggaac gcttccacga       180
     aagagtgtca tgctcacatt cgatgatggt tatcttgata actggctcag agcatggccg       240
     gtcctgaagg aatataacct tcatgcacat atttttctca ttacggggct gattggtaag       300
     ggaaacgtac gtagcaggca ggagcaggaa tattctcacc gcgactgtga acggttgatt       360
     gccgataacc gttcagatga ggtcatgctt cgctggtctg aagtccggga aatgcgtgat       420
     tccggactgg ttgaatttca tgtgcacacc cattcacata aacgctggga caggttgtct       480
     gtatcacgtg ctgaacagtg ccggctcatg aaagaagata ttctggtggg aaaacaatgt       540
     ctgacggaaa agctggggtt ctgtagttcc catctgtgct ggcctgaagg atattataat       600
     cgggattata ttaatctcgc cggtaagctt ggtttctctt atttatatac aaccgaaaga       660
     agaatgaact gtcctgaaaa tggttcatta cgcatagggc gtatcagcac caaagagcgg       720
     gaacattccg gctggctgaa acgacgcctt ttttattata caacgccact tttttcttca       780
     gtactggctc ttcataaggg gccaagatta ccagataatt aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page