(data stored in SCRATCH zone)

EMBL: CP001163.PE85

CP001163.PE85        Location/Qualifiers
FT   CDS_pept        71215..72318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0112"
FT                   /product="UDP-sugar hydrolase"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34474"
FT                   /protein_id="ACI34474.1"
FT                   /translation="MKILFTESSSDIGGQELQALAQMTALQKQGHSVLLACREKSKIAP
FT                   EARKRGHDVTFIPFRNSLHLPSILRLRRIIGEFKPDLVICHSGHDSNIAGLSRLICCHR
FT                   FSIVRQKTYITRKTRTFSLNYLCDFIVVPSSAMMAHLMAEGVRTPVTVIPPGFDWPALH
FT                   NEAMRPLPLHIHAWAASADNVPLIVQVGMLRPEKGHEFMLRVLYQLKMEGKSFRWLVVG
FT                   AGREEYEARLRQQTEHLGMSGDVLMAGALFPALPVYRIASVVVMPSENEAFGMVLAEAS
FT                   VSGVPVIASETGGIPDVIQKNVTGTLLPVGDVSAWTGALRDFLSRPERFRMMAASARED
FT                   IEYRFDINRTAQIIVSLASQAKGKCNR"
     atgaaaattt tattcactga atcttcgtca gatattgggg gccaggagct gcaggcactg        60
     gcccagatga ctgctcttca aaagcaggga cattccgttt tacttgcctg cagagaaaaa       120
     agtaaaattg ctccggaagc cagaaaaaga gggcatgatg tcacttttat tcctttcagg       180
     aacagccttc accttccttc catcctcaga cttcgacgga ttatcgggga atttaaacct       240
     gatctggtca tctgccatag tggccatgac agtaatatag caggactgag ccgtctgata       300
     tgctgtcacc gcttcagtat tgtcagacaa aaaacctaca tcacccgtaa gaccagaacg       360
     ttttccctga attatctgtg tgatttcatt gttgtgccta gctcagccat gatggcgcat       420
     ctgatggcgg aaggtgtcag gacaccggta acggttattc caccgggttt cgactggccc       480
     gcattgcata atgaagccat gcgaccgtta cccctgcata tccacgcctg ggctgcatca       540
     gcagacaatg ttccgcttat cgttcaggtg gggatgctac gtcccgaaaa aggacatgaa       600
     tttatgctgc gtgtattgta tcagctgaag atggaaggga aatcatttcg ctggctcgtg       660
     gtgggcgccg ggcgtgaaga atacgaagca cgtctgcgtc agcagacaga acacctggga       720
     atgagcggag atgtgttaat ggcaggtgcc cttttcccag cgttaccggt ctaccggatt       780
     gccagtgtgg tggtcatgcc ttcggaaaat gaagcgtttg gtatggtact ggctgaagcg       840
     tcagtctccg gcgtgcccgt tatcgccagt gagacgggcg ggatccctga tgtcattcag       900
     aagaatgtga cagggacgct gttacccgtg ggggatgtgt ctgcatggac cggcgcactg       960
     cgcgattttt tatcccgacc ggaacgcttc cggatgatgg cagccagcgc cagagaagat      1020
     attgagtacc ggtttgatat taacagaacg gcacagatca ttgtgtctct ggctagtcag      1080
     gctaagggga aatgcaacag ataa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page