(data stored in SCRATCH zone)

EMBL: CP001163.PE86

CP001163.PE86        Location/Qualifiers
FT   CDS_pept        72408..74129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0113"
FT                   /product="sulfatase domain protein"
FT                   /note="identified by match to protein family HMM PF00884"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34507"
FT                   /protein_id="ACI34507.1"
FT                   /translation="MHLNTGQNRPTFSWSALGWAIFYFGFFSTLLQVIIFSSGYSGTNG
FT                   IRDSLLFSCLWLIPVFLYPDRIKIIAAVVGFILWGTSLAALCYYFLYGHEFSQSVLFVM
FT                   FETNAREAGEYFSQYFSLKLLLISLVYTAVSVFLWTRLRPVYIPLPWRRIVSFLLLYAL
FT                   LLHPVVLKSLIRQEPLNDTLGKLASRMEPAAPWQFVSSYYQYHQQLNALTTFLNENSAL
FT                   PPLGNLRDESGERPRTLVLVIGESTQRERMSLYGYLRETTPELDALRKTDPGLTVFNNV
FT                   VASRPYTIEALQQALTFANEKNPDLYLTQPSLMNMMKQAGYKTFWITNQQTITARNTML
FT                   TVFSRQTDRQYYMNQQRTQSAREYDTNVLKPFREVLNDPAPKKLIIVHLLGTHIKYKYR
FT                   YPEGQGRFDGITGHIPTGLNAKELEVYNDYDNANLFNDHVVASLIKDFRATAPDGFLLY
FT                   FSDHGEEVYDTPPYKTQGRNEDNPTRPMYTVPFLLWTSEKWHAAHPRDFSQYVDRKYSL
FT                   AELIHTWSDLAGLTYDGYDPTRSLVNPQFRETTRWIGNPYKKNGLTDFDTLPYGEP"
     atgcatttaa ataccggaca gaacaggcct actttcagct ggagcgcgct gggatgggca        60
     attttttatt ttggcttttt ttccactctc ctgcaggtca tcatcttcag cagtgggtac       120
     agcggaacga atggaatacg ggactcactg ttattcagtt gtctgtggtt gatcccggtg       180
     tttctctatc ctgatcggat aaaaataatt gcagctgttg tcggtttcat tctctggggc       240
     acgtcgctgg cagcactttg ttattatttt ctctatggtc atgaattctc tcaaagtgtt       300
     cttttcgtta tgtttgaaac gaatgccaga gaggctggtg aatatttcag ccagtatttc       360
     agccttaaac tgttgcttat ctcgctggta tatactgcgg tgtccgtttt tctgtggaca       420
     cgtctgcgtc ctgtatatat tcctttgcca tggcggagaa ttgtctcttt cctgctgctt       480
     tatgctctgc ttctgcatcc ggttgttctg aaatcgttaa tcagacagga gccgctgaat       540
     gatactctag gcaaactggc atcccgaatg gagcctgctg ccccctggca gtttgtatcc       600
     agttattatc agtaccatca gcaactgaat gcactgacaa ccttcctgaa tgaaaatagc       660
     gcactgccac cactgggtaa tctcagggat gaatcagggg agagaccacg cacactggtc       720
     ctggtgattg gtgagtcgac acagcgcgaa cgcatgagct tatacgggta tctacgtgaa       780
     acgacgccgg agctggatgc actgcgtaaa accgatccgg gtcttactgt gtttaataat       840
     gtggtggcat cgcgtccgta caccattgaa gcattgcaac aggcccttac tttcgccaac       900
     gaaaagaatc ctgatctgta tctgacgcag ccgtcgctga tgaacatgat gaagcaggca       960
     ggctataaaa cattctggat taccaaccag cagacaatca cagcccgtaa caccatgctc      1020
     actgtatttt cgcgccagac ggacaggcag tactacatga atcagcagcg aacacaaagt      1080
     gcgcgtgaat atgacactaa cgtgctgaag ccgttccggg aagtgctgaa tgaccctgca      1140
     ccaaagaaac tgatcatcgt gcatctgctg ggtacgcaca ttaagtataa ataccgttat      1200
     ccggaaggtc aggggcggtt tgatggcatt acagggcata ttcccactgg attaaatgcg      1260
     aaagagctgg aagtgtataa cgattacgat aatgccaatc tgtttaacga tcatgtggtg      1320
     gccagtctga taaaggactt cagagcaact gcgccggacg gctttctgct ttatttttca      1380
     gaccatggtg aagaagtata tgatactccg ccatataaaa cgcagggacg gaatgaagat      1440
     aaccccacac gtcccatgta cactgttccg ttcctgctgt ggacctcgga aaagtggcat      1500
     gctgcacatc cgcgagattt ttcgcagtat gttgaccgca aatacagtct ggctgaactg      1560
     atccacacct ggtcagattt ggcgggactg acatacgatg gttacgatcc gacccgttct      1620
     ctggtgaatc cgcaattcag ggaaaccacc cgctggattg gaaatccgta taaaaagaat      1680
     gggctcactg atttcgacac tcttccgtat ggtgagccat ag                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page