(data stored in SCRATCH zone)

EMBL: CP001163.PE88

CP001163.PE88        Location/Qualifiers
FT   CDS_pept        complement(75250..75375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0115"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34465"
FT                   /protein_id="ACI34465.1"
FT                   /translation="MRSASFRASLRNSGECYLRGFLLVGTVFLSYEPPLTESLLT"
     atgcgttcag caagcttcag ggcttcactg cgaaattcag gcgaatgcta tttacggggt        60
     tttttactgg ttggtactgt ttttttgtca tatgagccac ctctgactga gagtttactc       120
     acttag                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page