(data stored in SCRATCH zone)

EMBL: CP001163.PE89

CP001163.PE89        Location/Qualifiers
FT   CDS_pept        75548..75949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0116"
FT                   /product="IS66 family element, orf1"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34511"
FT                   /protein_id="ACI34511.1"
FT                   /translation="MGTKVSDMQKNVTPGRRKGCPNYPPEFKQQLVAASCEPGISISKL
FT                   ALENGINANLLFKWRQQWREGKLLLPSSESPQLLPVTLDAAAEQPESLAEDPEPLSISC
FT                   EVTFRHGTLRFNGNVSEKLLTLLIQELKR"
     gtgggaacca aagtatcaga tatgcagaaa aatgtgactc ccggcaggcg aaaaggctgc        60
     cctaattatc ctcccgaatt taaacagcag ctcgttgctg cctcctgtga acccgggata       120
     tccatctcaa aacttgctct tgaaaatggc attaacgcca atctgttgtt caaatggcga       180
     caacaatggc gcgagggaaa gctgctatta ccttcttcag agagccccca gctacttcct       240
     gtgactctcg atgcagctgc cgaacagcca gaatcgctcg cagaggaccc ggaacccctc       300
     agtatcagct gtgaggtaac gttccggcac gggacgctcc gcttcaatgg caatgtcagc       360
     gaaaagctcc tgactctgct gatacaggaa ctgaagcgat ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page