(data stored in SCRATCH zone)

EMBL: CP001163.PE90

CP001163.PE90        Location/Qualifiers
FT   CDS_pept        75946..76293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0117"
FT                   /product="IS66 family element, orf2"
FT                   /note="identified by match to protein family HMM PF05717"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34420"
FT                   /protein_id="ACI34420.1"
FT                   /translation="MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFI
FT                   FRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPSARDGKVFLTQAQLAMLLEGIDWRQ
FT                   PKRLLTSLTML"
     atgatcccgt taccttccgg gaccaaaatt tggctggttg ccggtatcac cgatatgaga        60
     aatggcttca acggcctggc tgcgaaagta caaacggcgc tgaaagacga tcccatgtcc       120
     ggccatgttt tcattttccg gggccgcagc ggcagtcagg ttaaactgct gtggtccacc       180
     ggtgacggac tgtgcctcct gaccaaacgg ctggagcgtg ggcgcttcgc ctggccgtca       240
     gcccgtgatg gcaaagtgtt ccttacgcag gcgcagctgg cgatgctgct ggaaggtatc       300
     gactggcgac agcctaagcg gctgctgacc tccctgacca tgctgtaa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page