(data stored in SCRATCH zone)

EMBL: CP001163.PE92

CP001163.PE92        Location/Qualifiers
FT   CDS_pept        complement(77972..78088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0119"
FT                   /product="transposase IS3/family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34473"
FT                   /protein_id="ACI34473.1"
FT                   /translation="MPMSGKRYPEDFKIEAVKQVVDRGHSASSVATLRHAEA"
     gtgcccatga gcggtaagcg ttatcccgaa gattttaaaa ttgaagcggt aaaacaagtt        60
     gttgaccgcg gtcattctgc ttccagcgtt gcaacacttc gccatgctga ggcctga          117
//

If you have problems or comments...

PBIL Back to PBIL home page