(data stored in SCRATCH zone)

EMBL: CP001163.PE94

CP001163.PE94        Location/Qualifiers
FT   CDS_pept        78551..81247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0001"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34517"
FT                   /protein_id="ACI34517.1"
FT                   /translation="MNTKMNERWRTPMKLKYLSCTILAPLAIGVFSATAADNNSAIYFN
FT                   TSQPINDLQGSLAAEVKFAQSQILPAHPKEGDSQPHLTSLRKSLLLVRPVKADDKTPVQ
FT                   VEARDDNNKILGTLTLYPPSSLPDTIYHLDGVPEGGIDFTPHNGTKKIINTVAEVNKLS
FT                   DASGSSIHSHLTNNALVEIHTANGRWVRDIYLPQGPDLEGKMVRFVSSAGYSSTVFYGD
FT                   RKVTLSVGNTLLFKYVNGQWFRSGELENNRITYAQHIWSAELPAHWIVPGLNLVIKQGN
FT                   LSGRLNDIKIGAPGELLLHTIDIGMLTTPRDRFDFAKDKEAHREYFQTIPVSRMIVNNY
FT                   APLHLKEVMLPTGELLTDMDPGNGGWHSGTMRQRIGKELVSHGIDNANYGLNSTAGLGE
FT                   NSHPYVVAQLAAHNSRGNYANGIQVHGGSGGGGIVTLDSTLGNEFSHEVGHNYGLGHYV
FT                   DGFKGSVHRSAENNNSTWGWDGDKKRFIPNFYPSQTNEKSCLNNQCQEPFDGHKFGFDA
FT                   MAGGSPFSAANRFTMYTPNSSAIIQRFFENKAVFDSRSSTGFSKWNADTQEMEPYEHTI
FT                   DRAEQITASVNELSESKMAELMAEYAVVKVHMWNGNWTRNIYIPTASADNRGSILTINH
FT                   EAGYNSYLFINGDEKVVSQGYKKSFVSDGQFWKERDVVDTREARKPEQFGVPVTTLVGY
FT                   YDPEGTLSSYIYPAMYGAYGFTYSDDSQNLSDNDCQLQVDTKEGQLRFRLANHRANNTV
FT                   MNKFHINVPTESQPTQATLVCNNKILDTKSLTPAPEGLTYTVNGQALPAKENEGCIVSV
FT                   NSGKRYCLPVGQRSGYSLPDWIVGQEVYVDSGAKAKVLLSDWDNLSYNRIGEFVGNVNP
FT                   ADMKKVKAWNGQYLDFSKPRSMRVVYK"
     atgaacacta aaatgaatga gagatggaga acaccgatga aattaaagta tctgtcatgt        60
     acgatccttg cccctctggc gattggggta ttttctgcaa cagctgctga taataattca       120
     gccatttatt tcaatacctc ccagcctata aatgatctgc agggttcgtt ggccgcagag       180
     gtgaaatttg cacaaagcca gattttaccc gcccatccta aagaagggga tagtcaacca       240
     catctgacca gcctgcggaa aagtctgctg cttgtccgtc cggtgaaagc tgatgataaa       300
     acacctgttc aggtggaagc ccgcgatgat aataataaaa ttctcggtac gttaaccctt       360
     tatcctcctt catcactacc ggatacaatc taccatctgg atggtgttcc ggaaggtggt       420
     atcgatttca cacctcataa tggaacgaaa aagatcatta atacggtggc tgaagtaaac       480
     aaactcagtg atgccagcgg gagttctatt catagccatc taacaaataa tgcactggtg       540
     gagatccata ctgcaaatgg tcgttgggta agagacattt atctgccgca gggacccgac       600
     cttgaaggta agatggttcg ctttgtttcg tctgcaggct atagttcaac ggttttttat       660
     ggtgatcgaa aagtcacact ctcggtgggt aacactcttc tgttcaaata tgtaaatggt       720
     cagtggttcc gctccggtga actggagaat aatcgaatca cttatgctca gcatatttgg       780
     agtgctgaac tgcctgcgca ctggatcgtg cctggtttaa acttggtgat taaacagggc       840
     aatctgagcg gtcgcctaaa tgatatcaag attggagcac cgggtgagct gttgttgcat       900
     acaattgata tcgggatgtt gaccactccc cgggatcgct ttgattttgc caaagacaaa       960
     gaagcacata gggaatattt ccagaccatt cctgtaagtc gtatgattgt taataattat      1020
     gcgcctctac acctaaagga agttatgtta ccaaccggag agttattgac agatatggat      1080
     ccaggaaatg gtgggtggca tagtggtaca atgcgtcaaa gaataggtaa agaattggtt      1140
     tcgcatggca ttgataatgc taactatggt ttaaatagta ccgcaggctt aggggagaat      1200
     agtcatccat atgtagttgc gcaattagcg gcacataata gccgcggtaa ttatgctaat      1260
     ggcatccagg ttcatggtgg ctccggaggt gggggaattg ttactttaga ttccacattg      1320
     gggaatgagt tcagtcatga agttggtcat aattatggtc ttggtcatta tgtagatggt      1380
     ttcaagggtt ctgtacatcg tagtgcagaa aataacaact caacttgggg atgggatggt      1440
     gataaaaaac ggtttattcc taacttttat ccgtctcaaa caaatgaaaa gagttgtctg      1500
     aataatcagt gtcaagaacc gtttgatgga cacaaatttg gttttgacgc catggcggga      1560
     ggcagccctt tctctgctgc aaaccgtttc acaatgtata ctccgaattc atcggctatc      1620
     atccagcgtt tttttgaaaa taaagctgtg ttcgatagcc gttcctccac cggcttcagc      1680
     aagtggaatg cagatacgca ggaaatggaa ccgtatgaac acaccattga ccgtgcggag      1740
     cagattacgg cttcagtcaa tgagctaagt gaaagcaaaa tggctgagct gatggcagag      1800
     tacgctgtcg tcaaagtgca tatgtggaac ggtaactgga caagaaacat ctatatccct      1860
     acagcctccg cagataatag aggcagtatc ctgaccatca accatgaggc cggttataat      1920
     agttatctgt ttataaatgg tgacgaaaag gtcgtttccc aggggtataa aaagagcttt      1980
     gtttccgatg gtcagttctg gaaagaacgt gatgtggttg atactcgtga agcgcgtaag      2040
     ccagagcagt ttggtgttcc tgtgacgacc ctggtggggt attacgatcc ggaaggcacg      2100
     ctgtcaagct acatctatcc tgcgatgtat ggtgcctatg gcttcactta ttccgatgat      2160
     agtcagaatc tatccgataa cgactgccag ctgcaggtgg atacgaaaga agggcagttg      2220
     cgattcagac tggctaatca ccgggctaac aacactgtaa tgaataagtt ccatattaac      2280
     gtgccaacag aaagtcagcc cacacaggcc acattggttt gcaataacaa gatactggat      2340
     accaaatcgc tcacacctgc gccagaagga cttacctata ctgtaaatgg gcaggcactt      2400
     ccagcaaaag aaaacgaggg atgcatcgtg tccgtgaatt caggtaaacg ttactgtttg      2460
     ccggttggtc aacggtcagg atatagcctt cctgactgga ttgttgggca ggaagtctat      2520
     gtcgacagcg gggctaaagc gaaagtgctg ctttctgact gggataacct gtcctataac      2580
     aggattggtg agtttgtagg taatgtgaac ccagctgata tgaaaaaagt taaagcctgg      2640
     aacggacagt atttggactt cagtaaacct aggtcaatga gggttgtata taaataa         2697
//

If you have problems or comments...

PBIL Back to PBIL home page