(data stored in SCRATCH zone)

EMBL: CP001163.REPA

CP001163.REPA        Location/Qualifiers
FT   CDS_pept        56108..56965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="ECH74115_B0089"
FT                   /product="replication initiation protein"
FT                   /note="identified by match to protein family HMM PF02387;
FT                   match to protein family HMM TIGR03474"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34421"
FT                   /protein_id="ACI34421.1"
FT                   /translation="MTDLQQTYYRQVKNPNPVFTPREGAGTLKFCEKLMEKAVGFTSRF
FT                   DFAIHVAHARSKGLRRRMPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLAIECGLA
FT                   TESAAGKLSITRATRALTFLSELGLITYQTEYDPLIGCYIPTDITFTPALFAALDVSED
FT                   AVAAARRSRVEWENRLRKKQGLDTLGMDELIAKAWRFVRERFRSYQTELKSRGIKRARA
FT                   RRDAGRERQDIVTLVKRQLTREISEGRFTANREAVKREVERRVKERMILSRNRNYSRLA
FT                   TASP"
     gtgactgatc ttcaacaaac gtattaccgc caggtaaaga acccgaatcc ggtgttcaca        60
     ccccgtgaag gtgccggaac gctgaagttc tgcgaaaaac tgatggaaaa ggcggtgggc       120
     ttcacctccc gttttgattt cgccattcat gtggcacatg cccgttcgaa gggactgcgt       180
     cggcgcatgc caccggtact gcgtcgccgg gctattgatg cgctgctgca ggggctgtgt       240
     tttcactatg acccgctggc caaccgtgtc cagtgctcca tcaccacact ggccattgag       300
     tgcggactgg cgacggagtc tgctgccgga aaactctcca tcacccgtgc cacccgggcc       360
     ctgacgttcc tgtcagagct gggactgatt acctaccaga cggaatatga cccgcttatc       420
     gggtgctaca ttccgaccga catcacgttc acaccggctc tgtttgctgc ccttgatgtg       480
     tctgaggatg cagtggcagc tgcgcgccgc agccgtgttg aatgggaaaa caggctgcgc       540
     aaaaagcagg ggctggatac cctgggtatg gatgaactga tagcgaaagc ctggcgtttt       600
     gtgcgtgagc gtttccgcag ttaccagaca gagcttaagt cacggggaat aaagcgtgcc       660
     cgtgcgcgtc gtgatgcggg cagggaacgt caggatatcg tcaccctggt gaaacggcag       720
     ctgacgcgtg aaatctcgga agggcgcttc actgctaatc gtgaggcggt aaaacgcgaa       780
     gtggagcgtc gtgtgaagga gcgcatgatt ctgtcacgta accgcaatta cagccggctg       840
     gccacagctt ccccctga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page