(data stored in SCRATCH zone)

EMBL: CP001163.SOPA

CP001163.SOPA        Location/Qualifiers
FT   CDS_pept        18792..19949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sopA"
FT                   /locus_tag="ECH74115_B0045"
FT                   /product="plasmid partition protein A"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34522"
FT                   /protein_id="ACI34522.1"
FT                   /translation="METLNQCINAGHEMTKAIAIAQFNDDSPEARKITRRWRIGEAADL
FT                   VGVSSQAIRDAEKAGRLPHPDMEIRGRVEQRVGYTIEQINHMRDVFGTRLRRAEDVFPP
FT                   VIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDLHIHAED
FT                   TLLPFYLGEKDDVTYAIKPTCWPGLDIIPSCLALHRIETELMGKFDEGKLPTDPHLMLR
FT                   LAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQFFDMLRDL
FT                   LKNVDLKGFEPDVRILLTKYSNSNGSQSPWMEEQIRDAWGSMVLKNVVRETDEVGKGQI
FT                   RMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR"
     atggaaacac ttaaccagtg cataaacgct ggtcatgaaa tgacgaaggc tatcgccatt        60
     gcacagttta atgatgacag cccggaagcg aggaaaataa cccggcgctg gagaataggt       120
     gaagcagcgg atttagttgg ggtttcttct caggctatca gagatgccga gaaagcaggg       180
     cgactaccgc acccggatat ggaaattcga ggacgggttg agcaacgtgt tggttataca       240
     attgaacaaa ttaatcatat gcgtgatgtg tttggtacgc gattgcgacg tgctgaagac       300
     gtatttccac cggtgatcgg ggttgctgcc cataaaggtg gcgtttacaa aacctcagtt       360
     tctgttcatc ttgctcagga tctggctctg aaggggctac gtgttttgct cgtggaaggt       420
     aacgaccccc agggaacagc ctcaatgtat cacggatggg taccagatct tcatattcat       480
     gcagaagaca ctctcctgcc tttctatctt ggggaaaagg acgatgtcac ttatgcaata       540
     aagcccactt gctggccggg gcttgacatt attccttcct gtctggctct gcaccgtatt       600
     gaaactgagt taatgggcaa atttgatgaa ggtaaactgc ccaccgatcc acacctgatg       660
     ctccgactgg ccattgaaac tgttgctcat gactatgatg tcatagttat tgacagcgcg       720
     cctaacctgg gtatcggcac gattaatgtc gtatgtgctg ctgatgtgct gattgttccc       780
     actcctgctg agttgtttga ctacacctcc gcactgcagt ttttcgatat gcttcgtgat       840
     ctgctcaaga acgttgatct taaagggttc gagcctgatg tacgtatttt gcttaccaaa       900
     tacagcaata gtaatggctc tcagtccccg tggatggagg agcaaattcg ggatgcctgg       960
     ggaagcatgg ttctaaaaaa tgttgtacgt gaaacggatg aagttggtaa aggtcagatc      1020
     cggatgagaa ctgtttttga acaggccatt gatcaacgct cttcaactgg tgcctggaga      1080
     aatgctcttt ctatttggga acctgtctgc aatgaaattt tcgatcgtct gattaaacca      1140
     cgctgggaga ttagataa                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page