(data stored in SCRATCH zone)

EMBL: CP001163.SOPB

CP001163.SOPB        Location/Qualifiers
FT   CDS_pept        19949..20920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sopB"
FT                   /locus_tag="ECH74115_B0046"
FT                   /product="plasmid partition protein B"
FT                   /note="identified by match to protein family HMM PF02195;
FT                   match to protein family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34524"
FT                   /protein_id="ACI34524.1"
FT                   /translation="MKRAPVIPKHTLNTQPVEDTSLSTPAAPMVDSLIARVGVMARGNA
FT                   ITLPVCGRDVKFTLEVLRGDSVEKTSRVWSGNERDQELLTEDALDDLIPSFLLTGQQTP
FT                   AFGRRVSGVIEIADGSRRRKAAALTESDYRVLVGELDDEQMAALSRLGNDYRPTSAYER
FT                   GQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGD
FT                   ALQKAFTDKEELLKQQASNLHEQKKAGVIFEAEEVITLLTSVLKTSSASRTSLSSRHQF
FT                   APGATVLYKGDKMVLNLDRSRVPTECIEKIEAILKELEKPAP"
     atgaagcgtg cgcctgttat tccaaaacat acgctcaata ctcaaccggt tgaagatact        60
     tcgttatcga caccagctgc cccgatggtg gattcgttaa ttgcgcgcgt aggagtaatg       120
     gctcgcggta atgccattac tttgcctgta tgtggtcggg atgtgaagtt tactcttgaa       180
     gtgctccggg gtgatagtgt tgagaagacc tctcgggtat ggtcaggtaa tgaacgtgac       240
     caggagctgc ttactgagga cgcactggat gatctcatcc cttcttttct actgactggt       300
     caacagacac cggcgttcgg tcgaagagta tctggtgtca tagaaattgc cgatgggagt       360
     cgccgtcgta aagctgctgc acttaccgaa agtgattatc gtgttctggt tggcgagctg       420
     gatgatgagc agatggctgc attatccaga ttgggtaacg attatcgccc aacaagtgct       480
     tatgaacgtg gtcagcgtta tgcaagccga ttgcagaatg aatttgctgg aaatatttct       540
     gcgctggctg atgcggaaaa tatttcacgt aagattatta cccgctgtat caacacagcc       600
     aaattgccta aatcagttgt tgctcttttt tctcaccccg gtgaactatc tgcccggtca       660
     ggtgatgcac ttcaaaaagc ctttacagat aaagaggaat tacttaagca gcaggcatct       720
     aaccttcatg agcagaaaaa agctggggtg atatttgaag ctgaagaagt tatcactctt       780
     ttaacttctg tgcttaaaac gtcatctgca tcaagaacta gtttaagctc acgacatcag       840
     tttgctcctg gagcgacagt attgtataag ggcgataaaa tggtgcttaa cctggacagg       900
     tctcgtgttc caactgagtg tatagagaaa attgaggcca ttcttaagga acttgaaaag       960
     ccagcaccct ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page