(data stored in SCRATCH zone)

EMBL: CP001163.TRAX

CP001163.TRAX        Location/Qualifiers
FT   CDS_pept        51301..52047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traX"
FT                   /locus_tag="ECH74115_B0080"
FT                   /product="type-F conjugative transfer system pilin
FT                   acetylase TraX"
FT                   /note="identified by match to protein family HMM PF05857;
FT                   match to protein family HMM TIGR02755"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34462"
FT                   /protein_id="ACI34462.1"
FT                   /translation="MTTDNTNTTRNDSLAARTDTWLQSLLVWSPGQRDIIKTVALVLMV
FT                   LDHANRILHLDQTWMFLAGRGAFPLFALVWGLNLSRHAHIRQSAINRLWGWGIIAQFAY
FT                   YLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAGLLM
FT                   LAVSHRLYRAEDRTERLVLVACLLAVIPALNLASSDAAAVAGLVMTVLTVGLVSCAGKS
FT                   LPRFWPGDFFPTFYGCHLAVLGILAL"
     atgacaacgg ataacacgaa cacgacacgt aacgattcac tggctgcccg gaccgatacc        60
     tggttgcagt cgttgctggt ctggtcaccc ggacagcggg atatcatcaa aacggtggca       120
     ctggtgctga tggtactgga ccacgcaaac cgcattctgc atctggacca gacgtggatg       180
     tttctggccg ggcgtggagc ctttccgttg tttgctctgg tgtgggggct gaatctgtcc       240
     cgccatgcgc atatcaggca gtcggccatt aaccggctgt ggggatgggg aattattgcc       300
     cagttcgcgt attatctggc aggctttccg tggtatgagg ggaatatcct gtttgccttt       360
     gcagtggcgg cacaggtgct gacgtggtgt gaaacgcgca gtgggtggcg tacagcagcg       420
     gccattctcc tgatggcact gtgggggcct ttgtccggca ccagttacgg cattgccggg       480
     ctgctgatgc tggcagtcag ccaccggctg taccgggcgg aagacagaac ggaacgtctg       540
     gtgctggttg catgcctgct ggccgtgatt ccggcactta accttgcctc cagtgatgcg       600
     gcggctgtag ctggtcttgt gatgacggtg ctgaccgttg gtctggtgtc ctgtgcaggg       660
     aaatcattac cccgtttctg gcccggagat tttttcccga cgttctatgg ctgtcatctg       720
     gctgtgctgg gcattctggc gttgtga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page