(data stored in ACNUC30630 zone)

EMBL: CP001275.ASD

CP001275.ASD         Location/Qualifiers
FT   CDS_pept        complement(367919..368971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="trd_0366"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF02774; match to protein
FT                   family HMM TIGR00978"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06345"
FT                   /db_xref="GOA:B9KY23"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY23"
FT                   /protein_id="ACM06345.1"
FT                   /translation="MSDRIDVAILAATGSVGQRFVQLLAGHPWFRIAELVASDRSAGKR
FT                   YAEAVNWRISAAPPEEVRDLVVKHIEEPINSPIVFSALPGGVAGPIEEALAAEGKKVFT
FT                   NARDHRMDPDVPLLIPEVNPDHARAIERQRQLRGWREGFIVANPNCSTIHLVLALKPIH
FT                   DAFGIERGIVTTLQASSGAGYPGVPSLDLIDNVIPYIGGEEEKIEAESRKILGRWIDGT
FT                   FEDAPIVLSAHCNRVPVRDGHLETVSLDLHRSATPAEVIDVLRAFRALPQELELPSAPR
FT                   HPVIVLEEPDRPQPVLDRDAERGMASVVGRVRPCSVFDIRFVVLGHNTIRGAAGASVLN
FT                   AELFYREGLL"
     gtgtccgatc gaatcgacgt cgccatccta gcggcaaccg gtagcgtcgg ccagcgcttc        60
     gtccaactcc tcgctggcca cccctggttc cggatcgctg aactcgtcgc gagcgaccgc       120
     tcggccggga agcgctatgc ggaagcggtg aactggcgca tcagcgctgc cccgccagaa       180
     gaagtgcgcg atcttgtggt gaagcacatc gaagaaccga tcaacagccc gatcgtcttc       240
     tcggcccttc ccggtggggt cgctgggccg atcgaggagg cgttggccgc tgaaggaaag       300
     aaggtgttca cgaacgcgcg cgaccatcgg atggatccgg atgtgcccct tctcatcccc       360
     gaggtgaacc ccgatcatgc ccgggcgatc gagcgacagc ggcagctccg cggatggcgc       420
     gaggggttca tcgtggccaa ccccaactgc tcgacgatcc atctcgtcct cgcactcaag       480
     ccgattcacg atgcgttcgg gatcgagcga ggcatcgtca ccacactcca ggcatcctcg       540
     ggtgccggct atcctggtgt tccttcactc gatctgatcg ataacgtcat cccgtacatc       600
     ggtggagaag aagaaaagat cgaggccgaa tcacgtaaga tcctcggtcg ctggatcgac       660
     ggtaccttcg aggacgctcc gatcgtgctc agtgcgcact gcaatcgagt ccccgtgcgc       720
     gacggacacc tggagaccgt gagcctggat ctccatcgtt cggcgacccc ggcggaggta       780
     atcgacgtgc tgcgagcgtt ccgtgcgctt ccacaggaac tggaactccc cagtgctccc       840
     cgtcaccccg tcatcgtgct cgaggagccc gaccggccgc agccggtgct cgaccgagac       900
     gccgaacgtg gtatggcatc ggtcgtcggc cgggttcggc cttgctcggt gttcgacatc       960
     cggttcgtcg tcctcggcca caacacgatc cgcggagccg ccggagcctc ggtcttgaac      1020
     gccgagcttt tctaccgcga agggttgctc tag                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page