(data stored in ACNUC30630 zone)

EMBL: CP001275.CMK

CP001275.CMK         Location/Qualifiers
FT   CDS_pept        433800..434546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="trd_0438"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="identified by match to protein family HMM PF02224;
FT                   match to protein family HMM TIGR00017"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06064"
FT                   /db_xref="GOA:B9KY93"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY93"
FT                   /protein_id="ACM06064.1"
FT                   /translation="MVAGACQLVVAIDGPAGSGKSTVGAEVAKRLGALYFDTGVVYRVL
FT                   ALLALERGIAPDDAERLAQLAQNLSIRVGPPSIQDGRLYDVWLDGRDVTWAIRTPEIDR
FT                   LASLVSAHPPVRRALLRLQRELARNGRVVIAGRDIGTVVMPEAPVKIWLHASLEERARR
FT                   RQRDLARRGIVRSLEEIVAELADRDRRDATRAIAPMRPAEDAVIIDTDDRTIEEVVETV
FT                   LAVVRERCECANHGSDSAGVAPLAAP"
     gtggtggcag gggcatgcca gctcgtcgtg gcgatcgacg gcccagcggg gtcaggaaag        60
     agcaccgtcg gcgctgaagt cgccaaacga ctcggtgcac tgtacttcga tactggggtt       120
     gtctatcggg tgctcgcctt gctggcgctg gagcggggaa tcgcaccgga cgatgcagaa       180
     cgattggcgc aactggcgca gaacctgtcg attcgggtcg gtccaccttc gatccaggac       240
     gggcggctct atgacgtctg gctggacggt cgcgatgtga cctgggcgat ccgaacccca       300
     gagatcgatc ggctcgcttc cctggtttcg gcccatccgc cggtccggcg ggctctcctc       360
     cgcttgcagc gggagctagc gcgcaacggg cgcgtcgtca tcgctggccg ggatatcggc       420
     accgtggtca tgccggaagc cccggtgaag atttggttgc acgcatcgct ggaagagcgg       480
     gcgcgacggc gacaacgtga cttggcgcga cggggaatcg tgcgctcgct ggaggagatc       540
     gtcgcggaat tggctgaccg tgatcgccgg gatgcgacgc gagctattgc cccgatgcgt       600
     ccggctgagg atgcggttat catcgatacg gatgatcgta ccatcgaaga ggtcgtcgaa       660
     acggtgctcg cggtcgtccg cgagcgatgc gagtgtgcga accatggatc ggattccgcc       720
     ggagtggcgc ctctcgcggc gccgtaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page