(data stored in ACNUC30630 zone)

EMBL: CP001275.CST2

CP001275.CST2        Location/Qualifiers
FT   CDS_pept        19365..20432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cst2"
FT                   /locus_tag="trd_0018"
FT                   /product="CRISPR-associated regulatory protein, DevR
FT                   family"
FT                   /note="identified by match to protein family HMM TIGR01875;
FT                   match to protein family HMM TIGR02585"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05967"
FT                   /db_xref="InterPro:IPR010154"
FT                   /db_xref="InterPro:IPR013414"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1B7"
FT                   /protein_id="ACM05967.1"
FT                   /translation="MAGRATYPVVTGTVLIEASGAALNNAGQDEGRRTDNAIVVKQLQI
FT                   GRLRYPYVSGQAWRRWWREVLYTDFGWTPSPVTREAKSAYTEGNPIDYAEDDLFGYMAA
FT                   RKRGKDSDTYRRVSPLRASLLVSVLPNVIVSDFGHFSRNLPPGSDIIPFESEVYSTYLQ
FT                   GVFSIVLSEVGRFAVGAMADISAELAQKNGSRLRKAAVNPNQAEIYELPVRDRVQRVCE
FT                   ALQALARLRGGARLARNLSDVTPVAVIVGFLDGGNAPFQNLFVSDPVNAEQVLLNLERF
FT                   RSVLSDYTDRFLKVNNDKAVLLGLRPTVLANENEVREVIARKERPFDRVELLDSPRRAL
FT                   ERAAELVEQAYASIG"
     atggcaggac gagccacgta tccagtggtg accgggaccg ttctcatcga agcgagtggg        60
     gccgcgctca acaatgctgg tcaggatgag ggacgtcgca ccgataatgc gatcgtcgtg       120
     aagcagctgc aaatcggtcg cctgcgctat ccctatgtgt cgggtcaggc ctggcgacgc       180
     tggtggcggg aagtcctcta caccgatttc ggctggacac caagcccggt tacccgtgag       240
     gccaagagcg cgtacactga gggcaacccg atcgactacg ccgaagacga tctcttcggc       300
     tacatggcag cgcgcaagcg cggaaaggac tccgatacct accggcgcgt ctcgccgctc       360
     cgggcgagcc tgctcgtctc ggttctcccg aacgtcatcg tcagcgactt tggacacttc       420
     tcgcgaaatc tgcctcccgg tagtgacatc attccgttcg aatcagaagt ctattcgacc       480
     tacctgcagg gagttttcag tatcgtcctg agcgaggtcg ggcgattcgc ggtcggagcg       540
     atggccgaca tctctgcaga gctggctcag aagaacggta gccgccttcg caaggctgcg       600
     gtcaacccca accaggccga gatctacgaa ctcccggtta gggatcgtgt ccagcgcgta       660
     tgcgaggcat tgcaagcgct ggcacggtta cgcggtgggg cccgtctggc gcgcaacttg       720
     tcggatgtca cccccgttgc cgtgatcgtt ggcttcctcg atggagggaa cgcgccattc       780
     cagaatctgt tcgtgagtga tccagtgaat gcggagcaag tgctgttgaa tctcgagcgt       840
     ttccgttctg tgttgagtga ctacactgac cgcttcctca aggtcaataa cgataaggcg       900
     gttctgctcg gcttgcgccc gaccgttctg gccaacgaaa acgaggttcg cgaagtgatc       960
     gctcgcaagg agcgtccatt cgatcgagtc gagttgctcg actcaccgcg ccgagcgctc      1020
     gagcgggccg cggaactggt cgagcaggcc tacgcttcga tcggatga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page