(data stored in ACNUC30630 zone)

EMBL: CP001275.FTSW

CP001275.FTSW        Location/Qualifiers
FT   CDS_pept        71022..72296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="trd_0062"
FT                   /product="cell division protein FtsW"
FT                   /note="identified by match to protein family HMM PF01098;
FT                   match to protein family HMM TIGR02614"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05308"
FT                   /db_xref="GOA:B9L280"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:B9L280"
FT                   /protein_id="ACM05308.1"
FT                   /translation="MRWCLRRVMDALAVPGERRLAHEPDLVLLLTLLGLVTFGMVMVFS
FT                   ASVGSDPGYAVRHAIWLALGALAALATAALDYRIWRRLAVLALLGALGLMTLVLLPGFG
FT                   DTRLGAQRWIELGPLSFQPSEMAKLALVLYLASWLASKGERIRRFDLGVLPFMLLLGLL
FT                   GGLTMLQPDLGTAIVLGFTGLAMFFAAGATLRHTVLLGGIALVAGTVLAFGAPYRRDRI
FT                   LILFSSDQELFDPNGLLRTLGWQIAQARLAFGSGGWFGVGLGMGRQKFQWLPHAHNDAI
FT                   FAVIGEELGVVGCLVLLLLFLILAWRGLSIARRAPDRFGGLLAVGITSWLVSQALINAG
FT                   GISSVLPFTGIPLPFVSYGGSSLITSLAAAGILVNISRVTLPRPAPTSAAPRERPRHAP
FT                   PAVSLSRFGRRGRRRVAPRAGGRHP"
     atgcgctggt gccttcgtcg cgtcatggac gctctcgcgg taccgggcga gcgtcgcctg        60
     gcgcatgagc ctgatctggt cttgctcctc actctactgg ggctcgtcac cttcgggatg       120
     gtgatggtct tcagcgccag cgtcgggagt gatcccggtt acgcggtgcg ccacgcgatc       180
     tggctcgcgc tgggggcgct cgcggcgctc gccacggcgg cactggatta ccggatctgg       240
     cggcggctcg ctgtcctcgc tctcctcggc gcgctcgggc tcatgacgct cgtgctcctg       300
     cctggcttcg gtgacacgcg cttgggcgcc cagcgctgga tcgagctcgg accgctctcg       360
     ttccagccgt cggagatggc caaactcgcc ctggtacttt acctggcgag ttggttggcg       420
     agcaaggggg agcggatccg gcgtttcgac ctcggggtgc ttcccttcat gttgctgctc       480
     ggcctcctgg gtggtttgac gatgctgcag ccggatctgg gaacggctat cgtcttgggc       540
     tttaccggcc tggccatgtt cttcgccgca ggtgcgacgc tgcgccatac cgtgctcctg       600
     ggtggtatcg ctctggtggc ggggacggtg ctggctttcg gcgctcccta ccggcgggac       660
     cgcattctca tcctcttcag ctcggatcag gaactgttcg atcccaacgg gcttctccgc       720
     acgctcggct ggcagatcgc ccaggctcgt ctggccttcg ggagcggagg ttggttcggg       780
     gtcgggctcg ggatggggcg acagaagttc caatggctgc cgcatgccca caacgacgcc       840
     attttcgccg tcatcggcga agaactcggt gtcgtcggtt gtctcgtcct gctcctcctg       900
     ttcttgattc tcgcctggcg tggactcagt atcgcgcggc gggcgcccga tcgtttcggg       960
     ggactcctcg cggtgggaat caccagctgg ctcgtgagtc aagcgctgat caatgccggt      1020
     gggatcagct cggtactccc attcaccggt atcccactcc ccttcgtgag ctatggcggc      1080
     tcttcgctca tcacatcgct cgcggcagca ggaatcctgg tcaacatctc gcgggtcacg      1140
     ctgccgcggc cggcgccgac gtcagctgcg ccacgcgagc gtccgcggca cgctccgccg      1200
     gccgtctcat tgagccgttt tggccggcgc gggcgacgtc gggttgcgcc gcgagccgga      1260
     ggacgtcatc catga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page