(data stored in ACNUC30630 zone)

EMBL: CP001275.HISB

CP001275.HISB        Location/Qualifiers
FT   CDS_pept        complement(430134..430742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="trd_0434"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="identified by match to protein family HMM PF00475"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04665"
FT                   /db_xref="GOA:B9KY89"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY89"
FT                   /protein_id="ACM04665.1"
FT                   /translation="MTEIRRASIRRTTTETDVSVDLIIDGTGRSSVATGIGALDHFLTL
FT                   FARHGRFDIDIQARGDLHVDAHHTVEDVALCLGQALRRALGDWRGIRRMADAAVPMDEA
FT                   LAQVAVDLSGRGSFHYRDPWPGGAVGQLEADLVRHFLETLAREARITIHVVTLYGSNVH
FT                   HQIEAIFKALARALDAATELDTRIAGQLPSTKEHLEIQG"
     ttgacagaaa tccgaagagc ctccattcgg cgcacgacga ccgagaccga cgtcagtgtc        60
     gatttgatca tcgatggaac cggacgctcg agtgtcgcga ccgggatcgg tgcactcgac       120
     catttcttga cgctcttcgc gcgacacggg cgcttcgata tcgacatcca ggcgcgcggt       180
     gacctccatg tcgatgcgca ccatacggtg gaggacgtcg cgctctgcct cggtcaggcg       240
     ctccgacgcg ccctgggcga ctggcgcggt attcgtcgta tggccgatgc ggctgtgccg       300
     atggacgaag cgctcgccca ggtagccgtc gatctcagcg ggcgcggctc gtttcactac       360
     cgtgacccct ggccaggtgg ggccgtcggc caactcgagg ccgatctcgt ccgccacttt       420
     ctggagacgc tcgctcggga ggctcgcatc acgattcacg tggtgacact ctacggttcc       480
     aacgttcacc atcagatcga agcgattttc aaagcactgg cccgcgcgct cgatgccgcc       540
     accgaactcg atacccgcat cgctgggcaa ctgcccagta ccaaggaaca cctggaaatt       600
     caggggtga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page