(data stored in ACNUC30630 zone)

EMBL: CP001275.HISH

CP001275.HISH        Location/Qualifiers
FT   CDS_pept        186474..187118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="trd_0180"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF01174; match to protein
FT                   family HMM PF07685; match to protein family HMM TIGR01855"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04558"
FT                   /db_xref="GOA:B9KXJ3"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXJ3"
FT                   /protein_id="ACM04558.1"
FT                   /translation="MVIVVVDYGAGNLASVVNALERIGAPVIVSRHPAPLERADGVIVP
FT                   GVGAAADTMRHLEELGLVPALRAAIERGIPFLGICMGLQVLLEVSYEGGEHRCLGIVPG
FT                   VVRRLPEGITVPHMGWNEVWLRSSHPLFAGIPDGTDFYFVHSFYAEPSDSSWILGETDY
FT                   GVRFASVLARDNVMATQFHPEKSGFWGLRMLANFVDLVERTRGGLPLEAPV"
     atggtgatcg tcgtcgtcga ttatggagcc ggcaatctcg cgagtgtggt caatgcgctg        60
     gagcggatcg gcgcaccggt gatcgtcagt cgccatcccg caccgctcga gcgagcagac       120
     ggcgtcatcg ttccgggtgt gggtgctgcg gcggacacga tgcggcatct cgaggaactt       180
     gggctcgtgc cggctctccg tgccgcaatc gaacgtggta ttcccttcct cggaatctgc       240
     atgggactgc aggttttgtt ggaggtcagt tacgagggag gtgagcaccg ctgcctgggg       300
     atcgttcccg gtgtggtgcg tcgcttgccc gaggggatca ctgttcccca tatgggttgg       360
     aacgaggtct ggttgcgctc ttctcacccg ctcttcgctg gaattcccga tgggacggac       420
     ttttacttcg tgcactcctt ctatgctgag ccgagcgatt cctcatggat attgggtgag       480
     accgattacg gggtgcgctt tgccagcgtg ctcgctcgag acaacgtcat ggccacccag       540
     ttccatccgg agaagagcgg gttctggggg ttgcggatgc tcgcgaactt tgtcgatctc       600
     gtcgaacgaa cgcgtggcgg tttaccgttg gaggcaccgg tgtga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page