(data stored in ACNUC30630 zone)

EMBL: CP001275.ILVN

CP001275.ILVN        Location/Qualifiers
FT   CDS_pept        complement(616978..617505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="trd_0626"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM TIGR00119"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05466"
FT                   /db_xref="GOA:B9KYS2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYS2"
FT                   /protein_id="ACM05466.1"
FT                   /translation="MVSVRSHTLVVLVEDKPGVMNRIVSLFRQRGFNIDSIAVGHSETP
FT                   GLSRITLVAQGDDRKIEQLVKQLYKILEVIKITDVTDENLIQRELALIKVTATDRNRSD
FT                   IMRLVTDVYQARIVDATPDSLIVEVTGPPDKIDSLITMVRSYGIKEIARSGVIAMARGA
FT                   RVVATTPQPVVA"
     atggtgagcg tgcggagcca tacgctggtc gtcttggtcg aagacaagcc gggtgtcatg        60
     aaccggatcg tcagcctgtt ccgccagcgc ggattcaata tcgactcgat cgccgtcggc       120
     cactcggaga cgcccggctt gtcccgtatc acgctcgtcg cgcagggtga cgatcgcaag       180
     atcgaacaac tggtcaaaca gctgtacaag atcctcgaag tgatcaagat taccgatgtg       240
     acggacgaaa acttgattca acgcgaactc gccttgatca aggtcacagc gacggaccgg       300
     aatcgtagcg acatcatgcg cttggtcacg gacgtctatc aggcgcgcat cgtggacgcg       360
     actcccgatt cgctcatcgt cgaggtcacc ggaccaccgg ataagatcga ttctttgatt       420
     acgatggtgc ggtcttacgg gatcaaggag atcgcccgct ccggcgtcat cgccatggcc       480
     cgcggtgcgc gagtggttgc gacaactcca cagcccgttg tagcatga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page