(data stored in ACNUC30630 zone)

EMBL: CP001275.LIPA

CP001275.LIPA        Location/Qualifiers
FT   CDS_pept        173475..174386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="trd_0168"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.-"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00510"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05263"
FT                   /db_xref="GOA:B9KXI1"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXI1"
FT                   /protein_id="ACM05263.1"
FT                   /translation="MPSVRQPILLQKKPDWFRVRREHGPNYLELRRLVLEEGLHTVCQE
FT                   ARCPNIYECWNQRTATFMILGDRCTRACRFCNVRWGRSGTVDWEEPRRVAEAVERLGLD
FT                   FAVITSVNRDDLPDGGAAVFAATIREIRSRIPSCGIEVLIPDFLGNWYALRTVVEARPE
FT                   VIAHNIETVPRLFRVIQPWDDYGRSLELFRRVQAMDDAIALKSGLIVGMGETWDELLAV
FT                   MRDLREVGVEILTIGQYLPPTPRHFPLHRYYTLEEFEELRRIGEEELGYVYVESGPLVR
FT                   SSYHAKEQYERYRARRLEVRRG"
     atgccgtcgg tccgccagcc gattctgttg caaaagaagc cggactggtt ccgcgtgcgg        60
     cgggagcacg ggccgaacta tctcgaactc cggcgcctgg tgctggagga aggtttgcac       120
     acggtctgtc aagaggcgcg ttgccccaac atttacgaat gctggaacca gcgtaccgcg       180
     acgttcatga tcctcggcga tcgttgcacg cgggcgtgcc gattttgcaa tgtccggtgg       240
     ggacgaagcg gcacagtcga ctgggaagag ccgcgccggg tcgctgaggc ggtcgagcgt       300
     ttggggctgg acttcgcggt gatcacgtcc gtcaaccggg acgatctgcc tgatggtgga       360
     gctgctgtct tcgcggcgac gatccgtgag atccgctcac gcatcccctc gtgtggcatc       420
     gaggttttga ttcccgattt cctcggcaac tggtacgcac tgcgtaccgt cgtcgaggca       480
     cggcccgagg tgatcgcgca caatatcgag acggtgccgc gactcttccg cgtcatccag       540
     ccgtgggacg attacggccg gagcctcgaa cttttccgac gagtgcaggc gatggacgat       600
     gcgatcgcgc tcaagtcggg cctgatcgtc ggtatggggg agacgtggga cgagcttctt       660
     gctgtcatgc gcgatctccg tgaggtcggc gtggagatct tgaccatcgg gcaatatctg       720
     ccgccgacac cgcgacattt cccgctccat cgctactaca cgttggagga attcgaggag       780
     ctgcggcgga tcggcgagga agagttgggt tacgtgtacg tagagtccgg cccgctggtg       840
     cggtcgtcct accacgccaa ggagcagtac gagcgctatc gggcccgccg tctcgaggtg       900
     cgtcgggggt ag                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page