(data stored in ACNUC30630 zone)

EMBL: CP001275.MRAW

CP001275.MRAW        Location/Qualifiers
FT   CDS_pept        64032..65012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="trd_0056"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01795;
FT                   match to protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05553"
FT                   /db_xref="GOA:B9L274"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9L274"
FT                   /protein_id="ACM05553.1"
FT                   /translation="MSERARLALEDPLSTTHEPVLLSAALTFLAPRDGGRYIDATFGGG
FT                   GHSRAILEASAPSGQVLAIDADPAAVARARALAERYPGRLLPCHGNFRDLARLAQSYGF
FT                   VPVDGILFDLGLSSDQLADPARGFSFQLAGPLDMRFDPTSGEPAAVIVNTWSAEELAEL
FT                   FWQYGEEPRAWAIAQTIVAERARQPIETTTQLAALVARVAGSRRERIHPATRVFQALRI
FT                   AVNQELEALAAGLAQAVELLRPGGRLVVIAFHSLEDRLVKQFFRREAAACLCPPGTPVC
FT                   ICGHRPRLRLLTPRPVRPSAEEITRNPRSRSARLRAAERIAHDGR"
     atgagcgaac gcgcacgact cgcgctggaa gacccactgt cgaccacaca cgagccggtc        60
     ctgctgagcg ctgcgctgac ctttctggct cctcgcgatg gcggccgcta catcgatgcg       120
     accttcggcg gtggtgggca cagccgcgcc atcctggagg ccagcgcacc gagcgggcag       180
     gtgcttgcca tcgatgccga cccggctgca gtcgctcgtg cccgcgcgct ggctgagcgc       240
     tacccgggac ggctcctgcc ctgccatggt aacttccgcg atctggcgcg tcttgcccag       300
     tcgtacggat tcgttccggt cgatggcatc cttttcgatc tcggcttgag ttccgaccaa       360
     ctggccgacc cagctcgtgg tttttccttt cagctggccg ggccgctgga catgcgcttc       420
     gaccccacca gcggtgaacc agcggccgtc atcgtcaaca cgtggtcagc cgaggagctg       480
     gccgaacttt tctggcagta tggggaagag ccgcgggcgt gggccattgc ccagacgatc       540
     gttgccgagc gcgcgcgcca gccgatcgag acgacgaccc aactcgcggc tttggtcgcg       600
     cgcgtcgccg gtagccggcg cgagcgaatc catcccgcga cgcgcgtttt ccaggccttg       660
     cgcatcgcgg tcaaccagga actcgaggcg ctcgctgccg gactggcgca agcggtggaa       720
     cttttgcgtc ccggggggag gctggtggtg atcgctttcc actcgctgga agaccgtctc       780
     gtcaagcagt tcttccggcg cgaggcagcg gcgtgcctct gcccgccggg cacgccggtc       840
     tgcatctgtg ggcaccggcc gcgcttgcgt ctcctcacgc cgcgtccggt gcgcccgagt       900
     gcggaggaga tcacacgcaa cccgcgcagc cggagtgccc ggctgcgagc tgccgagcgg       960
     atagcgcacg atggtcgctg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page