(data stored in ACNUC30630 zone)

EMBL: CP001275.MRAY

CP001275.MRAY        Location/Qualifiers
FT   CDS_pept        68578..69597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="trd_0060"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="identified by match to protein family HMM PF00953;
FT                   match to protein family HMM TIGR00445"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05117"
FT                   /db_xref="GOA:B9L278"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="UniProtKB/TrEMBL:B9L278"
FT                   /protein_id="ACM05117.1"
FT                   /translation="MMDLFEVLRTRSVLPRDPGENLALSLALSGVAFVITVGIGKPYIA
FT                   WLRRHKIGKQIRLEGPEGHLTKLGTPTMGGFMITVPVILLTLLFNLAGRLSMLLPLGVL
FT                   IGTAVLGAIDDRLSLVTTGRGGMTARFKMAWLLLFSLAAALVLHFPLGLRSIYIPFLGK
FT                   FEIGLWYLPIAVLAIAGTANAVNLTDGLDTLAGGTAAVAFTAYGIIAFLQGQIQVVTFC
FT                   FTMVGAILGFLWYNAHPAQVFMGDTGSLALGAALATAAFMTGQWLLLPVIGIVFVAEAL
FT                   SVILQVAYYKLTKGKRLLRMAPLHHHFELIGWSETQITMRFWLISMMAGLLGIALALV"
     gtgatggatc ttttcgaagt cctgcggacg cgcagcgtcc taccgcgcga cccaggagag        60
     aacctggcgc tgtcgctcgc gctctctggt gtggccttcg tcatcacggt cgggatcggc       120
     aagccgtaca ttgcctggtt gcggcggcac aagatcggca agcagatccg gctggaaggg       180
     ccggaaggcc atctgaccaa actggggaca ccgaccatgg gcggcttcat gatcacggtg       240
     ccggtcatcc tgttgacgct cctctttaac ctggccgggc gactgtccat gctcttgccg       300
     ctcggcgtcc tgatcggcac cgcggtgctt ggtgcgatcg atgaccggtt gagtctggtc       360
     accactggtc gcggcgggat gacggcacgc ttcaagatgg cctggctgct ccttttctcg       420
     ctcgctgcag cgctcgtgct gcatttcccg ctcggtctgc gcagtatcta tattccgttc       480
     ctcggcaaat tcgagatcgg tctctggtac ctgccgatcg cggtcctcgc gatcgccgga       540
     acagccaatg ccgtgaacct gaccgatggg ctcgatacgc tggcgggggg aaccgcggcg       600
     gtcgccttca ccgcctacgg gatcatcgcg ttcctccagg ggcagatcca ggtcgtgacg       660
     ttctgcttca ccatggtcgg cgcgatcttg ggttttctct ggtacaacgc gcatccggct       720
     caggtcttca tgggggatac cggctccctg gctctcggtg cagcactggc gaccgcggcc       780
     ttcatgactg gccaatggct tctgctgccg gtcatcggga tcgtcttcgt cgcggaggcg       840
     ctttcggtca tcctgcaggt cgcctattac aagctgacga agggaaagcg gctcctccgc       900
     atggcgccgc tccaccacca cttcgaactg atcggctggt cggagacgca gatcacgatg       960
     cgtttttggt tgatcagtat gatggccggg ctcctgggca tcgcgctcgc actggtgtga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page