(data stored in ACNUC30630 zone)

EMBL: CP001275.NRDR

CP001275.NRDR        Location/Qualifiers
FT   CDS_pept        77748..78233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="trd_0069"
FT                   /product="transcriptional regulator, NrdR family"
FT                   /note="identified by match to protein family HMM PF03477;
FT                   match to protein family HMM TIGR00244"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04997"
FT                   /db_xref="GOA:B9L287"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9L287"
FT                   /protein_id="ACM04997.1"
FT                   /translation="MKCPYCGARDARVIDSRELNGGESIRRRRECIACGRRFTTYERVE
FT                   PIWLMVVKRDGRREPFDVGKLREGLRLALKKRPVSPDEIDRIVATVERELQSLGTSEVP
FT                   STLIGEIVLRELKQLDDVAYIRFASVYRRFADLEDLRREMEALGWRPRAAVTVDETS"
     gtgaagtgcc cgtactgcgg tgcgcgcgat gcccgcgtga tcgactcgcg cgagctcaac        60
     ggtggggaaa gcatccgtcg tcgacgcgag tgcatcgcct gtggccgccg cttcacgacc       120
     tacgagcgcg tcgagccgat ctggctgatg gtggtcaagc gcgatgggcg gcgcgagccg       180
     ttcgatgtcg gcaagttgcg ggaggggttg cgactcgcgc tcaagaagcg gccggtctcg       240
     ccggacgaga tcgaccgcat cgtggcgacc gtagagcgcg aactgcagtc gctcgggacg       300
     agcgaggtgc cgagcacgct gatcggcgag atcgtgctcc gcgaactcaa gcaactggac       360
     gatgtggctt acatccgctt cgcgtcggtc tatcggcgct tcgctgacct ggaggacctg       420
     cgccgagaga tggaggcgct cgggtggcgt cctcgagccg cggtgacggt ggacgagacc       480
     agctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page