(data stored in ACNUC30630 zone)

EMBL: CP001275.PE1

CP001275.PE1         Location/Qualifiers
FT   CDS_pept        102..1154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0002"
FT                   /product="DNA polymerase III tau and gamma subunits"
FT                   /note="identified by match to protein family HMM TIGR00678"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06107"
FT                   /db_xref="GOA:B9L1A1"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1A1"
FT                   /protein_id="ACM06107.1"
FT                   /translation="MNATNDLSPSRATPGWPIIGHEGAVRTLARAIESGQVHHAYLLAG
FT                   PAGIGRTTLAFVFAQALLCEGAAEQRPCGTCRSCQRIARRVHPDVTRIGLDTGAEEAKQ
FT                   VSIDQVRELRASLSLRPLEGAWRVAIVDDAERLSREAADALLKTLEEPPPYAVLVLVAE
FT                   DAQALPETIRSRCQTIVLQPLPISVVARALEVRGAAPELANRLARETRGRIALAFRLVS
FT                   DEAARVQREKRVAEVIAAMTEPLAAIGFARRLAEQYRRGRRAEVLSSLQLALELWRDAL
FT                   WLAADPSAPIVHEDARTTLERFARRCGIAGACAGLSATLQALADLEANVQARLALDAAM
FT                   VTWAEVSRCA"
     gtgaacgcga cgaacgacct ctcgccatct cgagcgacac ccggttggcc gatcatcggg        60
     cacgagggag cggtcaggac gctcgcccgg gccatcgaaa gcggccaggt gcatcatgcc       120
     tacctcctgg ctggtccggc cgggatcggg cggacgacgc tcgctttcgt cttcgcccaa       180
     gccttgctct gcgagggagc agctgagcag cggccgtgcg ggacctgccg ctcctgccag       240
     cggatcgcgc gccgcgtcca ccccgacgtg acgcgtatcg gcctggatac cggggcagaa       300
     gaggcgaagc aggtctcgat cgatcaggtg cgcgagctcc gggcgagtct cagtctgcgt       360
     cccctggaag gcgcgtggcg ggtcgcgatc gtcgacgatg ccgagcggct ttcgcgcgag       420
     gccgccgatg ccttgctgaa gaccttggag gaacctccgc cgtacgctgt gctcgtgctc       480
     gtcgccgagg atgcccaagc gttgcccgag accatccgct cccgctgcca gacgatcgtg       540
     ctgcagccgc tgccgatatc ggtcgtcgcg cgcgcactcg aggtgcgggg tgcggcgccg       600
     gagttggcga accggctcgc gcgcgagact cggggacgga tcgcgctcgc gtttcgcttg       660
     gtcagcgacg aggctgcgcg ggttcaacgc gagaagcgcg tggctgaggt gatcgccgct       720
     atgaccgagc cgctcgccgc catcggcttc gcgcggcgct tggctgagca gtaccggcgg       780
     gggcgtcgcg ccgaggtcct ctcgtcgctc cagctcgcac tcgagctgtg gcgcgatgcg       840
     ctctggctcg ctgctgatcc gagtgctccg atcgtgcacg aagatgcccg cacgacgctc       900
     gagcggttcg ctcgccgctg tgggatcgcc ggtgcgtgtg ctggtctttc ggcgaccctt       960
     caggcactag cggacctcga ggcgaacgtg caggcgcgcc tcgcgctcga tgccgcgatg      1020
     gtgacctggg cggaggtgag ccggtgcgca tag                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page