(data stored in ACNUC30630 zone)

EMBL: CP001275.PE121

CP001275.PE121       Location/Qualifiers
FT   CDS_pept        complement(129807..130970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0123"
FT                   /product="putative oxidoreductase protein"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05323"
FT                   /db_xref="GOA:B9KXD7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXD7"
FT                   /protein_id="ACM05323.1"
FT                   /translation="MSSDDVVIVGGGNLGLWTAYHLAQRGVRRILVCERYWAGYGATVR
FT                   SAGIMRQQGGSETAVKLGKWSRELYRKLGQELGLDSGFREVGYYVVASSPMEKAVFQRL
FT                   VELRTAHGVPNEWLDPEDLARRLPYVDWSRFAGATYTPNDGYVEPAIIVRNIVMAVRAA
FT                   GVELLEQCEVQGIEPLTSGYRVETSRGVFETERVIDAGGPRGARRIAEFVGIDVPVAAS
FT                   RHMVISFPERPPDMPANFPMMFVLAAGFYLRPDEQGVLLGFSNPLEQPDPSDRYLLEFD
FT                   WDYFEKLKPEWEATIPSLAGKAIGRAWTGSIDYTPDQLPIIDEPRFGFYVLAAGGHGIM
FT                   WGPALGMKMAELVTEERLSDLDPEEVRLRRFTEGRMATDAIHLPFPH"
     atgagtagcg acgacgtcgt gatcgtcggc ggtggaaatc tcggtctctg gaccgcctac        60
     cacctggccc agcgaggggt acgtcggatc ctggtctgcg aacggtattg ggccgggtac       120
     ggcgccactg tgcgctcggc tgggatcatg cggcagcaag gcggttcaga aaccgccgtg       180
     aaactcggga aatggtcgcg cgagctgtac cgaaagctgg gccaggaact cgggctggac       240
     agtggcttcc gtgaagtcgg ctactacgtc gtcgcctcta gtcccatgga aaaagcggtg       300
     ttccagcgcc tggtagaact gcgaactgct cacggcgttc cgaacgaatg gttggatcca       360
     gaggatctcg ctcggcgcct gccctatgtc gactggagcc gattcgccgg tgcgacttac       420
     acgcccaacg atggctatgt cgagccagcg atcatcgttc gcaacatcgt catggccgtg       480
     cgtgcagccg gcgtcgagct gctcgagcag tgcgaggtcc aggggatcga gccgctcacc       540
     agtggttatc gagtcgagac gtcgcgaggc gtattcgaga cggaacgggt gatcgatgct       600
     ggcggcccac gcggtgcccg gcggatcgcc gagttcgtgg ggatcgatgt accggtggct       660
     gcttcccggc acatggtgat ctccttcccg gagcgaccgc ccgacatgcc ggcgaacttt       720
     ccgatgatgt tcgttctggc tgctggcttt tacctacgcc cggacgagca gggagtgctc       780
     ttggggtttt cgaatccctt ggagcaaccg gacccgagcg atcgctacct tctggaattc       840
     gactgggact atttcgagaa gctcaagccg gagtgggaag cgaccatccc cagcttggca       900
     gggaaggcga tcggtcgagc ttggaccgga tcgatcgatt acacaccgga tcagcttccc       960
     atcatcgacg agccgcgctt cggcttctac gtgctcgccg cgggtggaca tgggatcatg      1020
     tgggggccgg ctctcggcat gaagatggcg gaattggtca cggaggagcg cttgagcgat      1080
     ctcgacccgg aggaagtgcg cttgcggcgc tttacggaag gtcggatggc caccgacgcc      1140
     attcatctcc ccttcccgca ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page