(data stored in ACNUC30630 zone)

EMBL: CP001275.PE126

CP001275.PE126       Location/Qualifiers
FT   CDS_pept        complement(135215..135898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0129"
FT                   /product="GntR-family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04471"
FT                   /db_xref="GOA:B9KXE2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXE2"
FT                   /protein_id="ACM04471.1"
FT                   /translation="MPAGLGNSRGHRQLLHQQAYEVIRNAIVQSDLPPGSVVSERTLSE
FT                   QFGFGRAPIRAAIQRLAAEGFLLIVPQQGIIVASPSLEEVRDLFELRVALESYVVRRLA
FT                   LEPQEVDFVHLELLLEKQEKAAQEQNVRLYRQLDVDFHLFLAHSLGNSELYSSMERLSD
FT                   RLHRIIASVISRRPARMLDSTIEHRAIVQAIATGDPDAAEMAMITHLDWAWNFLTGGHL
FT                   PRHGR"
     atgcctgctg gtctcgggaa ctcccgggga catcggcaac tcttgcacca acaagcgtac        60
     gaagtgatcc ggaacgctat cgtccagagc gacttgcctc cgggatcggt tgtctccgaa       120
     cgaacgctct ccgagcagtt cggtttcggg cgagccccga tccgagccgc aatacaacgg       180
     ctcgctgctg aaggatttct gctgatcgtg ccgcaacagg gaattatcgt cgcgagcccc       240
     tccctcgaag aggtccgaga cctcttcgag ttgcgcgttg cactggagtc atacgtcgtc       300
     cgtcgcttag ctctggaacc tcaggaggtg gatttcgtcc acctcgagct gttactggag       360
     aaacaggaaa aagccgcgca ggaacaaaac gtccgactct accgacaact cgatgtggat       420
     ttccaccttt tcctggcgca ctcgctcggg aacagcgaac tgtactcctc gatggagcgc       480
     ttgagcgatc gactccatcg catcatcgcg tctgtcattt cgagacgccc tgcccggatg       540
     ctcgacagta cgatcgagca tcgagcgatt gtccaggcca tcgccacggg cgatccggat       600
     gcagcggaaa tggctatgat cacccacctc gactgggctt ggaattttct cacaggaggc       660
     catctccctc gtcacggccg ttaa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page