(data stored in ACNUC30630 zone)

EMBL: CP001275.PE128

CP001275.PE128       Location/Qualifiers
FT   CDS_pept        complement(136830..138155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0131"
FT                   /product="ygbK domain protein"
FT                   /note="identified by match to protein family HMM PF07005"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04724"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXE4"
FT                   /protein_id="ACM04724.1"
FT                   /translation="MSVDFAYIADDFTGATDVLEALASAGARARLYLDCAPSAVEPGLQ
FT                   AIGIATTARATAAAELPNVLAPLFDALVSLQPAIVQYKVCSTFDSSPEIGNIATVISTA
FT                   WERFPYQSVLPVIVGAPRLGRWVVFGNLFARYGVTAKIYRLDRHPVMRFHPITPMEESD
FT                   LGVILHHQGLPHPVEYLTVLDYTLDQSTSFEKFQRTDRTVLIADTLLEEHLTTLGRLVL
FT                   AALRTPALVIGSSGATQAICNALIERGKFCGEPLLAAPYPVDPVLVVSGSCSRVSANQT
FT                   QRAIQAGFCEIAIVPDKLLHNDAYIEEVAEKIAQQLCRGKSVIAHTCSGPDDPRLLNRH
FT                   SPWERLHLGRELGRQLGELVARVAGRVPVRRIIVTGGDTSGYVALAAGLKALDPIAVIA
FT                   PGAPLCRACAPQTCLDGIEFCFKGGQTGPEDFYLIARDGVKT"
     atgtcggtcg acttcgcgta catcgccgac gacttcaccg gagcgactga cgtgctcgag        60
     gcactcgctt cagccggtgc ccgagcccgc ctctacctcg actgcgcccc gtccgctgtc       120
     gagccggggc ttcaggccat cggtatcgct accacggctc gtgcgacagc cgcggctgag       180
     ttaccgaatg tcctcgctcc cctgttcgat gcgctggtct ctcttcagcc agcaatcgtc       240
     caatacaagg tatgctccac cttcgattcc tcgccagaaa tcggcaacat cgccacggtg       300
     atttccacag cgtgggagcg ctttccatac cagtctgtgc ttcctgtgat cgtcggggca       360
     ccacgactcg ggcggtgggt cgtgtttggc aacctcttcg ctcgctatgg ggtcacggcg       420
     aagatctacc ggcttgatcg gcacccggtt atgcgcttcc atccgataac acccatggag       480
     gaaagcgatc tcggggtcat cttgcaccac caagggcttc cccaccccgt cgagtacctg       540
     actgtgctcg actacactct cgaccagtct acctcgttcg agaaattcca gcgcacagat       600
     cgaacggtac tcatcgccga caccctgctc gaggagcacc tgacaacact cggccgactg       660
     gttctcgcag cccttcgcac gccggcactg gtcatcggat cgagcggagc gactcaagcg       720
     atctgcaacg ctctcatcga aagagggaag ttctgtggag aaccactcct tgccgcaccc       780
     tatccagtcg acccggtcct tgtcgtaagc ggatcatgct cgcgtgtgtc tgcaaaccaa       840
     acacagcgag ccattcaagc tggtttctgc gaaattgcta tcgtaccaga taaattactc       900
     cacaatgatg cgtatattga ggaagtagca gaaaaaattg cgcaacagtt gtgtcgcggc       960
     aagagcgtga tcgcacacac ctgcagcggt cctgatgatc cccgcttgct gaaccgtcac      1020
     tcgccgtggg agcgcctgca tctcggccgt gaactcggtc gtcagctcgg cgagcttgtc      1080
     gcccgcgttg ccgggcgcgt ccccgtccgc cgcatcatcg tcaccggtgg cgatacctca      1140
     ggttatgtcg cactcgccgc tggcctcaag gcactcgatc cgatcgccgt aatcgctccg      1200
     ggtgcgcccc tttgccgtgc ctgcgctccg caaacctgcc tggacggcat cgaattctgt      1260
     ttcaaaggag gacagacagg tcctgaagac ttctatctca tcgcgcgaga cggcgtgaag      1320
     acgtga                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page