(data stored in ACNUC30630 zone)

EMBL: CP001275.PE131

CP001275.PE131       Location/Qualifiers
FT   CDS_pept        complement(140462..142204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05941"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXE7"
FT                   /protein_id="ACM05941.1"
FT                   /translation="MFQSLYPAVRDRNWATIPTRVTAWSVTGRDYEVIVTLSGVCGNEE
FT                   IALDWTGQVTASQAGLLQYAFEARARKDFWKNRIGLCIHIPATYAGAPARGIARDGTVT
FT                   DGALPVSIAPHQPFRNLAQFTFTLPDKRHCTIIFEGDIFEMEDQRNWSDASFKIYSTPL
FT                   DLPFPVLVHEGQVLFQRVTALIEPKETAPAKAELISLDCDPTPLTPVPFGTQLPPLTTA
FT                   DEMDRLTHCLALLQPDHLRLDVHAASVQADYLRAAAHLAKRTATPLLIALYATDPAQVQ
FT                   EVVPLLTALDAPLKALMLHHPAEKVTPPALLAALGDELHRIGPLPLAAGTDFFFAELNR
FT                   DPHPWPQADWIVFTMTPGVHALDDRSLLLNATIQGQVVESARAVAGGRPILVSPITLRM
FT                   RRNPNATTGGWDIPREEQVDRRLHAVFGAAWLLQSLASLATAQPVAVTYFELAGSLGIF
FT                   AEHGSAPGDRQNSEETLSFTPLASVMHRLLRTARNGARWFRARSTNPVQIQTLGILLQE
FT                   RWELLIANPWPSPQVVEITHLPGTIEGIDALHPLASPSMPALSQAVPLLALPPNAVVVL
FT                   WGRR"
     gtgtttcaat ccctctaccc cgctgtccgc gatcgcaact gggccaccat tccgactcgg        60
     gtgaccgctt ggtccgtgac cggccgagac tacgaagtga tcgtaacgct ttcaggagtt       120
     tgcggaaacg aggagattgc gctcgactgg acgggacagg tcactgcgag tcaggctggt       180
     cttctccagt acgcttttga ggcacgtgca cgcaaggatt tttggaagaa ccgaattggc       240
     ctctgcatcc acattccagc cacctacgca ggcgctccgg ctcgtggcat cgcccgggac       300
     ggtaccgtca cggacggagc actacccgtt tcgatcgccc cgcaccaacc gtttcgcaac       360
     ctcgcacaat ttacgttcac gcttccggac aagaggcatt gtacgatcat ttttgagggt       420
     gatatctttg aaatggaaga tcaaagaaat tggtctgacg catcttttaa gatatactca       480
     acgccgctgg atttaccatt tccggtactc gttcatgaag gacaggttct cttccagcgg       540
     gtcacagccc tgattgagcc caaggagaca gcaccagcga aagctgagtt gatcagcctc       600
     gactgcgatc ctacacctct gacgccagta cctttcggaa cccagcttcc accgctgacc       660
     accgctgacg agatggatcg actcacgcac tgcctcgccc ttctccaacc ggaccacctc       720
     cggcttgacg tgcatgccgc aagcgtgcag gcggactatc tccgtgctgc tgctcatctt       780
     gccaagcgca cggcgactcc gctcctcatt gccctctacg cgacggaccc cgctcaggtg       840
     caggaggtcg tccccctcct cactgcgctg gatgcaccgc tgaaggcact gatgttgcat       900
     catccggcag aaaaagtgac acctcctgcc ctccttgcgg cactcggtga cgaactccac       960
     cgaatcggcc ctctcccact cgctgccgga accgacttct tcttcgctga actgaaccgt      1020
     gacccgcacc cctggccaca agcggactgg atcgtcttca ccatgactcc cggagtacac      1080
     gcactggacg atcggagtct cctgctcaat gcgacgattc aagggcaggt cgtggagtcc      1140
     gctcgggccg tcgccggagg gcgtcccatc ctcgtctcgc ccatcacgct tcgcatgcgc      1200
     agaaatccca atgccacgac cggaggttgg gacatcccgc gcgaggagca agtggaccgg      1260
     cgccttcacg ccgttttcgg cgcagcgtgg ttgctccaaa gcctggcgag cctcgcaacc      1320
     gcccaaccgg tcgccgttac ctacttcgaa cttgccggta gtctcggtat ctttgcagaa      1380
     catggatccg ctccaggaga ccgtcaaaac agtgaagaaa ctctctcgtt cacccctctc      1440
     gccagcgtca tgcaccggct tctccgtacg gcgcggaacg gtgcccgctg gttccgtgct      1500
     cgctcgacga atccggtcca gatacaaacc ctcggcatcc tgttgcagga gcgctgggaa      1560
     cttctgatcg cgaatccctg gccttctcct caggtggtcg agatcaccca tcttccaggc      1620
     accatagaag gcattgacgc tcttcatccg ctggcgagtc cgtcgatgcc agcgctttct      1680
     caagcggttc cactgctcgc tctcccaccg aatgcggtcg ttgtcctctg ggggcgacga      1740
     tga                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page